[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57786.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   38->166 1dhyA PDBj 2e-05 14.7 %
:RPS:SCOP  39->171 1mpyA1  d.32.1.3 * 8e-07 14.3 %
:HMM:SCOP  35->157 1q0oA2 d.32.1.3 * 2.7e-11 22.2 %
:HMM:PFM   39->66 PF00903 * Glyoxalase 8.5e-06 35.7 28/128  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57786.1 GT:GENE BAD57786.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3119959..3120513) GB:FROM 3119959 GB:TO 3120513 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57786.1 LENGTH 184 SQ:AASEQ MGCMSDYFNAFEISPVPTPGPDVVAPEPFRGIYGMPAFVTIPTTDVAASLDFWTRGLGFIELFTIPGAVVHLRRWAFQDVLLVPAAAAATQPPAMSVSFACVLDQIDPLVEACRALRPDSVDGPRDTPWNTRDLEVRTPENARVIMTAAKPFDPAGPEARHLAAVGITAPEEVAGDNAEHARGQ GT:EXON 1|1-184:0| SEG 84->94|paaaaatqppa| RP:PDB:NREP 1 RP:PDB:REP 38->166|1dhyA|2e-05|14.7|129/278| HM:PFM:NREP 1 HM:PFM:REP 39->66|PF00903|8.5e-06|35.7|28/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 39->171|1mpyA1|8e-07|14.3|133/145|d.32.1.3| HM:SCP:REP 35->157|1q0oA2|2.7e-11|22.2|117/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -1----------------------------------11------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 70.1 SQ:SECSTR #####################################EEEEEcccHHHHHHHHHHTcccEEEEEEEccEEEEEEcccccccEEEEcccccccEEEEEEEcccHHHHHHHHHHHHHTTcEEEEEEEEcccccEEEEEEcccTTcEEEEEcccccccccEEcccEEEE################## DISOP:02AL 1-4, 175-184| PSIPRED cccHHHHcccEEccccccccccccccccccEEEccccEEEEEHHHHHHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHHEEccccHHHccccccEEEHHHHHccccHHHHHHHHccccccccccccccccEEEEEEcccccEEEEEEccccccccccccEEEEEcccccHHHccccccccccc //