[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57790.1
DDBJ      :             putative enoyl-CoA hydratase/isomerase family protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  74/915 : Eukaryota  78/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->172 2vssA PDBj 1e-09 29.5 %
:RPS:PDB   2->171 1dubA PDBj 6e-20 23.2 %
:RPS:SCOP  2->172 1dubA  c.14.1.3 * 6e-21 23.1 %
:HMM:SCOP  2->217 2f6qA1 c.14.1.3 * 1.5e-36 31.2 %
:RPS:PFM   20->172 PF00378 * ECH 3e-12 36.2 %
:HMM:PFM   19->173 PF00378 * ECH 5.8e-20 29.9 154/170  
:BLT:SWISS 8->172 FADB_PSYWF 5e-09 32.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57790.1 GT:GENE BAD57790.1 GT:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3123924..3124577) GB:FROM 3123924 GB:TO 3124577 GB:DIRECTION - GB:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GB:PROTEIN_ID BAD57790.1 LENGTH 217 SQ:AASEQ MTTLEFHDGIAVLDLGDGENRFSPAFLEQVNAHLDTALSDGALALVTTAGGKFYSNGLDLDWVAAHGERMPWYVEQVQALLARVLTFPLPSAAALPGHAFGAGAMLAMAHDYRVMRADRGYFCFPEVDIHIPFTPGMAALIQAKLTPAAAIASMTTGRRFGGGEAAAIGLVDATAAEGEVTAAALAMLAPLGGKDSGTLTAVKNTMFAGAVAALRAA GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 8->172|FADB_PSYWF|5e-09|32.5|154/719| SEG 173->191|ataaegevtaaalamlapl| BL:PDB:NREP 1 BL:PDB:REP 4->172|2vssA|1e-09|29.5|166/238| RP:PDB:NREP 1 RP:PDB:REP 2->171|1dubA|6e-20|23.2|168/260| RP:PFM:NREP 1 RP:PFM:REP 20->172|PF00378|3e-12|36.2|152/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 19->173|PF00378|5.8e-20|29.9|154/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 2->172|1dubA|6e-21|23.1|169/260|c.14.1.3| HM:SCP:REP 2->217|2f6qA1|1.5e-36|31.2|215/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 217 OP:NHOMOORG 154 OP:PATTERN -----------------1----------1--------------------------------------- --------------21-11-111111111111----2233---3-----------2-1--1----1----1-----------1-----------1------------1-----------------------------11---------------------------------------------1----------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1-----------------1------------------------------------------------------------------1-----------------------------------------1----------2----------1---323----------------------------------------------------------21---11-------1---------------------------------------------------------------------------------------------1-----------------------------1---------------------------1-11111111111111111------------------------------------------111111------------------------------------------------- ----22------11-1211111131122222221--22224223321111211211--11114---------------------------1121111111111111----6----------------------------------------------------22--------12--------1-2132131-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 217 STR:RPRED 100.0 SQ:SECSTR cEEEcGGGcEEEEEEccGGTcccHHHHHHHHHHHHHHHHcTTcEEEEEccccEEEccccHHHHTTccHHHHHHHTTTTTTTTGGGGccccEEEEEccEEETHHHHHHHHccEEEEcETTcEEEcGGGGGTccccccTTTHHHHHHcHHHHHHHHHHcccEEHHHHHHHTcccEEEcHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 215-217| PSIPRED cEEEEEEccEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEEccccEEEccccHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEcccccEEEccccEEcccccccHHHHHHHHHcHHHHHHHHHHcccccHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcHHHcc //