[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57798.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:238 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   33->90 PF11468 * PTase_Orf2 7e-04 39.3 %
:HMM:PFM   53->196 PF04307 * DUF457 2.8e-16 59.4 64/77  
:HMM:PFM   6->60 PF02673 * BacA 0.00063 25.5 55/259  
:BLT:SWISS 55->222 YDJM_SHIFL 2e-07 44.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57798.1 GT:GENE BAD57798.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3135476..3136192 GB:FROM 3135476 GB:TO 3136192 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAD57798.1 LENGTH 238 SQ:AASEQ MLGHSHATSGALAWSVAAATLPLAVVTYPVMQDVDARLGPVDVLLGVFLTAGAALLPDADHPKGTLAHVLGPLSYFACKIIAKVSGGHRQGTHSLLFVVAAAYGTWAGMHWIGRPFTLALAFFLLALAVRALHLYPPGDDIRSWGTVVVLAAAGTFVMDHWISDKPAWLPFCVGLGALAHLLGDCLTDRGCPLLWPFKPRTCFPIIERTGNKVETWVLAPLFTVGTLAVLWHVFTVPA GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 55->222|YDJM_SHIFL|2e-07|44.1|111/200| TM:NTM 6 TM:REGION 7->29| TM:REGION 38->59| TM:REGION 114->136| TM:REGION 141->163| TM:REGION 165->187| TM:REGION 214->236| SEG 16->27|vaaatlplavvt| SEG 116->134|ftlalaffllalavralhl| RP:PFM:NREP 1 RP:PFM:REP 33->90|PF11468|7e-04|39.3|56/288|PTase_Orf2| HM:PFM:NREP 2 HM:PFM:REP 53->196|PF04307|2.8e-16|59.4|64/77|DUF457| HM:PFM:REP 6->60|PF02673|0.00063|25.5|55/259|BacA| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1----111--------1211--------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHccccHHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccc //