[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57799.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  101/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->263 2arzA PDBj 2e-14 30.4 %
:RPS:PDB   41->264 2arzA PDBj 5e-33 33.2 %
:RPS:SCOP  42->263 2arzA1  b.45.1.1 * 8e-43 33.5 %
:HMM:SCOP  27->267 2arzA1 b.45.1.1 * 6e-53 38.5 %
:RPS:PFM   179->259 PF10615 * DUF2470 1e-11 48.1 %
:HMM:PFM   176->259 PF10615 * DUF2470 6.4e-21 42.0 81/83  
:HMM:PFM   31->117 PF01243 * Pyridox_oxidase 1.5e-17 31.7 82/89  
:BLT:SWISS 41->171 CREG1_MOUSE 9e-05 25.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57799.1 GT:GENE BAD57799.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3136526..3137332 GB:FROM 3136526 GB:TO 3137332 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57799.1 LENGTH 268 SQ:AASEQ MTLDHGDPGDAPSVPQPIAPVVDATRPSAAEEARTVVAATNIATLASLSEDGGPWASFVTYGELGGRPVLCVSRLAEHGRNLAADPRASLSIVAPDVPTDPLAGTRVTLAGVVEQPTGDEADAARNAHLAAVPAARHYIDYSDFTVWILRVHRVRWVGGYGRMDSATAEQYAAARPDPIVPAAARAVAHLNEDHADALADMARALGGYPDATTARCERADRYGLDLRVETPRGVARTRVGYLAPLDDVGQLRAATVELARRSRSGNRP GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 41->171|CREG1_MOUSE|9e-05|25.4|130/220| SEG 29->40|aaeeartvvaat| BL:PDB:NREP 1 BL:PDB:REP 52->263|2arzA|2e-14|30.4|204/238| RP:PDB:NREP 1 RP:PDB:REP 41->264|2arzA|5e-33|33.2|217/238| RP:PFM:NREP 1 RP:PFM:REP 179->259|PF10615|1e-11|48.1|81/83|DUF2470| HM:PFM:NREP 2 HM:PFM:REP 176->259|PF10615|6.4e-21|42.0|81/83|DUF2470| HM:PFM:REP 31->117|PF01243|1.5e-17|31.7|82/89|Pyridox_oxidase| RP:SCP:NREP 1 RP:SCP:REP 42->263|2arzA1|8e-43|33.5|215/238|b.45.1.1| HM:SCP:REP 27->267|2arzA1|6e-53|38.5|231/0|b.45.1.1|1/1|FMN-binding split barrel| OP:NHOMO 151 OP:NHOMOORG 119 OP:PATTERN -------------------------------------------------------------------- --1-----------1------1---1------11111-12------------------------------------------------------------------------------------------------111-------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111----------1-11111111111----1111--11-11-----------1-------------1111----------------------------------------111111111111111111111111---1---------------------111-------------------------------------------1--------------------------------1---11----------------------------------------------------------------------------------------------------------------------------------1-----------------------------1-11111111111111---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------2-1G222423142-2112----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 220 STR:RPRED 82.1 SQ:SECSTR ########################################cEEEEEEEccTTcEEEEEEEcEEcTccEEEEEETTcHHHHHHHHccEEEEEEEcTTTcccTTcccEEEEEEEEEEccHHHHHHHHHHHHHHcGGGTTccTTccEEEEEEEEEEEEEEcTTccEEEEETTTcccccTTTTTHHHHHHHHHHHHHcHHHHHHHHHTHHccccccccEEEEEcccEEEEEE####TTEEEEEEcccccccHHHHHHHHHHHHHcccc#### DISOP:02AL 1-5, 8-28, 264-268| PSIPRED cccccccccccccccccccccccccccHHHHHHHHHHHHccEEEEEEEcccccEEEEEEEEEEccccEEEEEEcccHHHHHHHHcccEEEEEEEccccccccccccEEEEEEEEEcccccHHHHHHHHHHHccHHHHHcccccEEEEEEEEEEEEEEEEccccEEEcHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEEEccccEEEEEccccccccHHHHHHHHHHHHHHHHHcccc //