[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57800.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  73/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.16
:290 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   93->203 3c8nC PDBj 1e-08 32.1 %
:RPS:PDB   8->261 2b81A PDBj 4e-29 18.6 %
:RPS:SCOP  11->205 1rhcA  c.1.16.3 * 1e-27 19.0 %
:HMM:SCOP  1->286 1rhcA_ c.1.16.3 * 2.8e-56 32.3 %
:RPS:PFM   85->206 PF00296 * Bac_luciferase 2e-21 41.0 %
:HMM:PFM   11->231 PF00296 * Bac_luciferase 6.3e-60 35.1 202/307  
:BLT:SWISS 1->288 Y965_MYCBO e-105 63.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57800.1 GT:GENE BAD57800.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3137416..3138288 GB:FROM 3137416 GB:TO 3138288 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57800.1 LENGTH 290 SQ:AASEQ MRFTYAETMTDPSFYVPLAQAAEAAGYTSMTIADSIAYPRDSDATYPYTPDGSREFLEDKPFVEAFVLSAAIAAATTRLRLTPFVLKLPIRPPVLVAKQAASVAALSGNRLGLGVGISPWPDDFEIMGVPFEKRGARMDECIDIVRGLTAGGYFEYHGEYYDLPPIKISPVPTEPIPILIGGHSKAALRRAAQRGDGWMHAGGDPQELDRLLAELDALRAEYGARKDFEIHVISVDGFTVDGVKRLEDKGVTDVIVGFRNPYTREPDNESLDTKIANLERFAEKVVARTS GT:EXON 1|1-290:0| BL:SWS:NREP 1 BL:SWS:REP 1->288|Y965_MYCBO|e-105|63.8|287/288| SEG 70->82|aaiaaattrlrlt| SEG 207->221|eldrllaeldalrae| BL:PDB:NREP 1 BL:PDB:REP 93->203|3c8nC|1e-08|32.1|109/324| RP:PDB:NREP 1 RP:PDB:REP 8->261|2b81A|4e-29|18.6|237/308| RP:PFM:NREP 1 RP:PFM:REP 85->206|PF00296|2e-21|41.0|122/296|Bac_luciferase| HM:PFM:NREP 1 HM:PFM:REP 11->231|PF00296|6.3e-60|35.1|202/307|Bac_luciferase| RP:SCP:NREP 1 RP:SCP:REP 11->205|1rhcA|1e-27|19.0|179/330|c.1.16.3| HM:SCP:REP 1->286|1rhcA_|2.8e-56|32.3|257/0|c.1.16.3|1/1|Bacterial luciferase-like| OP:NHOMO 254 OP:NHOMOORG 78 OP:PATTERN -----------------------12--1------------------------1--------------- 1---8---------2C833-38--B933333988A86578193F----1-----------226-2145222-----------4--------------------------------------------------------11----31-------------------1--1------------------------------------------------1---1-1------1---------------------------------------------------------------------------------------------------------------------------------------------1----------------------2--------------------1-------1-----------------------------------------------------------------------1--------1111------111------------------1--1--------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------1-----------------------------------------------------------------------------------1--------------1-11----------------------------11----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 269 STR:RPRED 92.8 SQ:SECSTR ###ccGGTccccTTHHHHHHHHHHHTccEEEEcccccccGGGccTTTTTcHHHHHccccccTTcccHHHHHHHTTccccEEEEEEEETTTccHHHHHHHHHHHHHHcTTcEEEEEEccccHHHHHHHTcccTTHHHHHHHHHHHHHHHHHccccEEEETTEEEEcccccccccccccEEEEccTTccHHHHHHcccEEcccccTHHHHHHHHHHHHHHHHHHcccEEETTEEEEcHHHHHHHHHHHHHHTccEEEEEcTTcTccccHHHHHH################## PSIPRED cccccccccccHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccEEccccEEcccccccccEEEEcccHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEcccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHcc //