[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57803.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  295/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->144 1yyvB PDBj 1e-12 41.5 %
:RPS:PDB   25->144 3echB PDBj 2e-05 15.2 %
:RPS:SCOP  19->144 1yyvA1  a.4.5.69 * 7e-23 37.8 %
:HMM:SCOP  20->150 2f2eA1 a.4.5.69 * 4.9e-26 36.0 %
:RPS:PFM   35->140 PF01638 * HxlR 4e-15 51.1 %
:HMM:PFM   66->138 PF01638 * HxlR 1.2e-22 43.8 73/91  
:BLT:SWISS 14->144 YTFH_SHIFL 3e-17 40.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57803.1 GT:GENE BAD57803.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3140178..3140633 GB:FROM 3140178 GB:TO 3140633 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57803.1 LENGTH 151 SQ:AASEQ MRSVTTMKASEKRAQAKVEYNAFLAGCPSRQLLERISDKWVVLILCALGGDNSSGRPGAADADGPKPMRYSEISRLLAGVSQKMLTQTLRSLERDGLLTRTVTPTVPVTVSYELTDLGLSLHHMTRGLRNWAQTHMAEVLAHRENYDTRTP GT:EXON 1|1-151:0| BL:SWS:NREP 1 BL:SWS:REP 14->144|YTFH_SHIFL|3e-17|40.5|116/126| SEG 101->110|tvtptvpvtv| BL:PDB:NREP 1 BL:PDB:REP 19->144|1yyvB|1e-12|41.5|106/107| RP:PDB:NREP 1 RP:PDB:REP 25->144|3echB|2e-05|15.2|112/135| RP:PFM:NREP 1 RP:PFM:REP 35->140|PF01638|4e-15|51.1|90/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 66->138|PF01638|1.2e-22|43.8|73/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 19->144|1yyvA1|7e-23|37.8|111/114|a.4.5.69| HM:SCP:REP 20->150|2f2eA1|4.9e-26|36.0|114/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 526 OP:NHOMOORG 297 OP:PATTERN ---------------------------------------1---1------------------------ 2---7--2222---1----------2----------3121-72722---11-211--1--21--5-2754------11----------1111-1-----------2--------------------------------------1---1211---111----------11-----------------------1666667362475457--2211513--1---1------53---------------1----1------------------1-1-----------------------------------------------1---11-----------1-----------------1-----------1-1-2-1122------21244---1211-----------2-2213232613--5553531245122111---3-----1111111111-212---1-------------------------------21-1-----12214--1111112-111111212--------21-1-----11------11-------------1--11------11--1-11----1--1---1---------------------------------1---------------------------------------1134-1-1111111111-111111111111111111111144--11111--1---11111121111111--211111111111---------1111--2-1----11-----1---22323-1----1----1-11------122-------------------1----21121211111111--------------------1-------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 83.4 SQ:SECSTR ##################cccTTcHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHccTTcEHTTTEEHHHHHHHHHccHHHHHHHHHTTcEEEEEccccTTcEEEEEcHHHHHHHHHHHHHHHHHHHHHHTTccHHH####### DISOP:02AL 1-2, 4-20, 147-151| PSIPRED cccccHHHHHHHHHHHHcccccccccccHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //