[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57811.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   89->161 3c5vA PDBj 2e-04 29.2 %
:RPS:PDB   224->310 1a8qA PDBj 1e-04 13.6 %
:RPS:SCOP  89->294 1a7uA  c.69.1.12 * 6e-05 14.4 %
:HMM:SCOP  29->305 1b6gA_ c.69.1.8 * 1.9e-29 23.9 %
:HMM:PFM   60->154 PF00975 * Thioesterase 1.4e-07 32.6 86/229  
:BLT:SWISS 89->161 PPME1_HUMAN 5e-04 29.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57811.1 GT:GENE BAD57811.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3147787..3148725) GB:FROM 3147787 GB:TO 3148725 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57811.1 LENGTH 312 SQ:AASEQ MRPRFRPHARGVDFSTYAAFLPPSLRGEPLAAPEPTWWPWRGRQVHIARATRPEASARILAVHGAGGHAGLVWPFAALAARAGIDAAAVDLPLYGDTREPDPRGVRYRDWVDLLTDLVRAETDADPRPLILFGASIGGLLAYEAAARSGRVAHVLATCLLDPADPAARRAAARWSWTGAAAPTLLGALGPAARLRVPIRWLADMANMSADPAVSRACATDPRGGGIRVPLGFLADYFTFEHTRPQHYTAAPVTLVHPAADRWTPPELSLRFLDRIAAEHRAVLLANCGHFPLEEPGVHVLRETIEAVIAATT GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 89->161|PPME1_HUMAN|5e-04|29.2|72/100| SEG 60->72|lavhgagghaglv| SEG 76->88|aalaaragidaaa| SEG 162->195|padpaarraaarwswtgaaaptllgalgpaarlr| BL:PDB:NREP 1 BL:PDB:REP 89->161|3c5vA|2e-04|29.2|72/294| RP:PDB:NREP 1 RP:PDB:REP 224->310|1a8qA|1e-04|13.6|81/274| HM:PFM:NREP 1 HM:PFM:REP 60->154|PF00975|1.4e-07|32.6|86/229|Thioesterase| RP:SCP:NREP 1 RP:SCP:REP 89->294|1a7uA|6e-05|14.4|201/277|c.69.1.12| HM:SCP:REP 29->305|1b6gA_|1.9e-29|23.9|272/0|c.69.1.8|1/1|alpha/beta-Hydrolases| OP:NHOMO 30 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- -------1111---1------1---1------111111----------------------------1-----------------------------------1-----------------------------------------------------------------------------------------------------------------------1-------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22--------1--1-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------- -------------------------------------------------111-1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 50.0 SQ:SECSTR ########################################################################################EccTTcTTcccccTTcccHHHHHHHHHHHHHHHHTTccccEEEEEETHHHHHHHHHHH#TTccTTEEEEEEEc##############################################################ccHHHHHHHHHHHHHcccHHHHTTccccEEEEEETTcccccGGGTHHHHHHHcTTcEEEEETTccTTTHHH###TTcTTHHHHHHHH## DISOP:02AL 1-11| PSIPRED cccccccccccccccccccccccccEEEcccccccEEEEccccEEEEEEEcccccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHcHHccHHHHHHHHHHHHHHccHHHHcccccccEEEEEccccccccHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHccc //