[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57814.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:330 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->292 PF09995 * DUF2236 1.5e-49 26.7 240/250  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57814.1 GT:GENE BAD57814.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3151139..3152131) GB:FROM 3151139 GB:TO 3152131 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57814.1 LENGTH 330 SQ:AASEQ MTTNAALPVVSETDTAPGGSATADRVRPEVLAEFRKHTASVLTGVFAASAFDQVALVPVAAAVDRSGRFAANFADRGVRSGASGILALWGDPVDRKAEAEWLKERHRDVHGHGKGAYRDVRYSALNPKSWVWIGVSGMFVPLNTFTYCTGIELRPAEQEAAYQMMRETFAELELASKSGKLPADLAAARRYYDDMVEHELATNPFLVREFAKLTRLPLPTLGISPVVRAVLLPLWLLIRPLVGHVIQVCSAQAMHPGVRRLVGFDLKRRHDIEFAVYVRVLQTAWRFLPDRLLLAPLAYNRLQYEKLVRAHRKYALDTFAVPSNESGCPI GT:EXON 1|1-330:0| TM:NTM 1 TM:REGION 225->247| SEG 183->194|adlaaarryydd| SEG 225->242|pvvravllplwllirplv| HM:PFM:NREP 1 HM:PFM:REP 32->292|PF09995|1.5e-49|26.7|240/250|DUF2236| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------111----1----------11111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 329-330| PSIPRED cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //