[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57827.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->56 PF09851 * DUF2078 0.00064 20.0 35/73  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57827.1 GT:GENE BAD57827.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3165447..3165659 GB:FROM 3165447 GB:TO 3165659 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57827.1 LENGTH 70 SQ:AASEQ MTSGQPGLDLLADHSVLLAIPAFLPALAVVAFIVTIAVRDRRAEEREKAAAGTDTADSETARPDPPEENR GT:EXON 1|1-70:0| TM:NTM 1 TM:REGION 15->37| SEG 16->34|vllaipaflpalavvafiv| SEG 39->51|rdrraeerekaaa| HM:PFM:NREP 1 HM:PFM:REP 22->56|PF09851|0.00064|20.0|35/73|DUF2078| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 42-70| PSIPRED ccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc //