[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57828.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.6.1d.87.2
:135 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  30->76 1ffuC1  d.87.2.1 * 7e-04 34.0 %
:HMM:SCOP  30->134 1sfdA_ b.6.1.1 * 1.1e-05 24.5 %
:HMM:PFM   28->69 PF03450 * CO_deh_flav_C 0.00016 38.1 42/103  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57828.1 GT:GENE BAD57828.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3165656..3166063 GB:FROM 3165656 GB:TO 3166063 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57828.1 LENGTH 135 SQ:AASEQ MTRPLGYAALVALTAAALTACGSDEPTAPRAEDFASASTAASNPAEDAVVIDVRIAGGTVTPTNAQAEAKVGQPITLVVDSDAEDELHVHASPEHTFPVRVGAGQRFTFTVDVPGRVEVELHDAGRTVTTLLVRP GT:EXON 1|1-135:0| SEG 8->20|aalvaltaaalta| HM:PFM:NREP 1 HM:PFM:REP 28->69|PF03450|0.00016|38.1|42/103|CO_deh_flav_C| RP:SCP:NREP 1 RP:SCP:REP 30->76|1ffuC1|7e-04|34.0|47/110|d.87.2.1| HM:SCP:REP 30->134|1sfdA_|1.1e-05|24.5|102/0|b.6.1.1|1/1|Cupredoxins| OP:NHOMO 23 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- --------------111----3---1------23341-11----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEcccEEcccccEEEEEcccEEEEEEccccccEEEEEccccccEEEEEccccEEEEEEEccccEEEEEEccccEEEEEEEEc //