[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57830.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   111->185 3bf4A PDBj 9e-11 16.4 %
:HMM:SCOP  107->171 2ftrA1 d.58.4.15 * 0.00084 19.4 %
:HMM:PFM   23->82 PF00291 * PALP 3.2e-06 35.4 48/297  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57830.1 GT:GENE BAD57830.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3167395..3168063) GB:FROM 3167395 GB:TO 3168063 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57830.1 LENGTH 222 SQ:AASEQ MAADSLIFALWGVPDPRDPAWVDELTGAGAREVILDVADDDVAAAMLRLTTFETPVEAVLSLVAEPATAAAVSAVLAGRAERVAGWRVETTAPLPPPTTPVGVRAPGLTNVAFLRRPAELAYDEWLARWRGAHTEVAIATQATFGYVQHRVLEPVTADAPEIAAVVEELFPIEALHDPHAFYGSGGDPAELGRRIEAMMASVATFGADRDLDVVPTSRYRLC GT:EXON 1|1-222:0| SEG 36->45|dvadddvaaa| SEG 63->80|vaepataaavsavlagra| SEG 90->100|ttaplpppttp| RP:PDB:NREP 1 RP:PDB:REP 111->185|3bf4A|9e-11|16.4|73/109| HM:PFM:NREP 1 HM:PFM:REP 23->82|PF00291|3.2e-06|35.4|48/297|PALP| HM:SCP:REP 107->171|2ftrA1|0.00084|19.4|62/0|d.58.4.15|1/1|Dimeric alpha+beta barrel| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--1111111111111-------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------1--1-----------------1---11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 32.9 SQ:SECSTR ##############################################################################################################EEEEEEEccTTccccHHHHHHTHHHHHHHGGGccEEEEEEccccccTTccccEEEEEEEEccHH##HHHHHHHHH##################################### DISOP:02AL 1-2| PSIPRED ccccEEEEEEEcccccccHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccEEEEccEEccccccccccccccHHHHHHEEccccccHHHHHHHHHHcccHHHHHHHHHccEEEEEEEEEEccccccHHHHHHHHccHHHcccHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccEEcc //