[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57832.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->144 2a61A PDBj 4e-08 23.4 %
:RPS:PDB   9->147 2a61A PDBj 4e-17 23.0 %
:RPS:SCOP  9->144 2a61A1  a.4.5.28 * 4e-18 23.5 %
:HMM:SCOP  1->143 2fbkA1 a.4.5.28 * 3.7e-24 30.0 %
:HMM:PFM   39->91 PF01047 * MarR 2e-15 26.4 53/59  
:BLT:SWISS 41->143 YXAD_BACSU 4e-11 32.0 %
:PROS 65->100|PS01117|HTH_MARR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57832.1 GT:GENE BAD57832.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3169791..3170288) GB:FROM 3169791 GB:TO 3170288 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57832.1 LENGTH 165 SQ:AASEQ MPVSTETAQNLIKELYLIGRAIRGALAHPDEGALLPGAIGVLSTLETKGSCRQGDLAVSICISPSALSRHVTDLVAAGYVSRTADPSDGRATLIEVTDAGRALLERIRVSRAEGLQSVLSDWSEEEAERACTAVRKLRNSLADNAHRSVAGERKPVSNESQGTDV GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 41->143|YXAD_BACSU|4e-11|32.0|103/143| PROS 65->100|PS01117|HTH_MARR_1|PDOC00861| BL:PDB:NREP 1 BL:PDB:REP 34->144|2a61A|4e-08|23.4|111/142| RP:PDB:NREP 1 RP:PDB:REP 9->147|2a61A|4e-17|23.0|139/142| HM:PFM:NREP 1 HM:PFM:REP 39->91|PF01047|2e-15|26.4|53/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 9->144|2a61A1|4e-18|23.5|136/139|a.4.5.28| HM:SCP:REP 1->143|2fbkA1|3.7e-24|30.0|140/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 85 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- ---12---111----11----1--11-----111112333121--1---2212221-3----1-3134341------------------------------------------------------------------------------------------------------------------------1----------------------1----------------11-------------------------------------------------1---1--------------------------------------------------------------------------------------------------1-------------------------------------11-11-------------------------------1-----------------------------------------------------------1-----1------1----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 89.1 SQ:SECSTR ccccccccHHHHHHHHHHHHHHHHHHHTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTc################## DISOP:02AL 1-4, 141-165| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc //