[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Plasmid : pNF2
Gene : BAD60774.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:52 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->31 PF01907 * Ribosomal_L37e 5.7e-05 44.4 18/55  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD60774.1 GT:GENE BAD60774.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210PL02 GT:ORG nfar0 GB:ACCESSION GIB00210PL02 GB:PLASMID pNF2 GB:LOCATION complement(80866..81024) GB:FROM 80866 GB:TO 81024 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD60774.1 LENGTH 52 SQ:AASEQ MGKGVANGPRTQGRGGPSSGPRKRRNHLGCRLATPSLRNLLAPALRNSLPTP GT:EXON 1|1-52:0| SEG 8->25|gprtqgrggpssgprkrr| HM:PFM:NREP 1 HM:PFM:REP 14->31|PF01907|5.7e-05|44.4|18/55|Ribosomal_L37e| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-26, 49-52| PSIPRED cccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHHHccccc //