[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Plasmid : pNF2
Gene : BAD60776.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:197 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD60776.1 GT:GENE BAD60776.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210PL02 GT:ORG nfar0 GB:ACCESSION GIB00210PL02 GB:PLASMID pNF2 GB:LOCATION complement(82913..83506) GB:FROM 82913 GB:TO 83506 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD60776.1 LENGTH 197 SQ:AASEQ MHQWCTPPGCRVVAALAVGRLRMAGESRNQRAGVRRTRQANVAGGRSHRCVVKLSDSEYADLTVRAEAAGMTVPRLLVETTLGKATPEVGRAAAALRALEEGEQDRRALNNLNQLVRYSHQNRELAEGLPLAVAAVVRAALQMDALARWVMGETPSVSPSVIGEDQLAAAQEWVERVDNLGVLGIDEDIDDVDGGGV GT:EXON 1|1-197:0| SEG 90->103|graaaalraleege| SEG 132->140|avaavvraa| SEG 180->196|lgvlgidediddvdggg| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 30-44| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccEEcccccccccccccc //