[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAG32218.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAG32218.1 GT:GENE BAG32218.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 23771..24016 GB:FROM 23771 GB:TO 24016 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAG32218.1 LENGTH 81 SQ:AASEQ MSEGHATGMTTVHVDFNDVARDGKVVALRDRADGPLAIGDLVTAVDQFDGELATPAVVAEQDDDGRVLYLAPLAGNRPEED GT:EXON 1|1-81:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,74-74,76-82| PSIPRED cccccccccEEEEEEHHHccccccEEEEEEcccccEEHHHHHHHHHHHcccccccEEEEEccccccEEEEEcccccccccc //