[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAG32220.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->69 PF02780 * Transketolase_C 0.00024 22.2 54/124  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAG32220.1 GT:GENE BAG32220.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 261978..262271 GB:FROM 261978 GB:TO 262271 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAG32220.1 LENGTH 97 SQ:AASEQ MFAFAWIDPLSPTPEWDLAQVRRLARRLGYELYRPDHPSVLGLAEQVTAAGAEVVLLPSSAHVDAVTLDRVLAVADVECAAPRVSFARWSSLGGVRR GT:EXON 1|1-97:0| HM:PFM:NREP 1 HM:PFM:REP 16->69|PF02780|0.00024|22.2|54/124|Transketolase_C| OP:NHOMO 6 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------6-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 95-98| PSIPRED cccEEEcccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHccccEEEEccHHHcccccHHHHHHHHHHHHcccccHHHHHHHcccccc //