[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAG32221.1
DDBJ      :             putative MutT family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->87 2pq1A PDBj 9e-10 42.4 %
:RPS:PDB   18->126 3dkuD PDBj 1e-16 18.3 %
:RPS:SCOP  18->128 2b06A1  d.113.1.1 * 5e-15 21.3 %
:HMM:SCOP  1->151 1ryaA_ d.113.1.5 * 2.6e-25 34.5 %
:RPS:PFM   24->129 PF00293 * NUDIX 8e-12 39.6 %
:HMM:PFM   19->129 PF00293 * NUDIX 3.6e-22 36.0 111/135  
:BLT:SWISS 18->128 RPPH_ROSDO 4e-08 30.6 %
:PROS 47->68|PS00893|NUDIX_BOX
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAG32221.1 GT:GENE BAG32221.1 GT:PRODUCT putative MutT family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 802383..802871 GB:FROM 802383 GB:TO 802871 GB:DIRECTION + GB:PRODUCT putative MutT family protein GB:PROTEIN_ID BAG32221.1 LENGTH 162 SQ:AASEQ MRRDQTKEVVVEDLASARLAAGALFREGERVLLVHKVYGNGWDLPGGYVEPGESPAAACRREVREELGIVREVRRLLVHDWAPMTGEGDKVLYVFDCGEIGVAEIRLDSAELDEWRWVPVGEVGELVIDRLARRVRHAYAAAVAGETRYLERGVLVGEAPLG GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 18->128|RPPH_ROSDO|4e-08|30.6|111/160| PROS 47->68|PS00893|NUDIX_BOX|PDOC00695| SEG 130->144|rlarrvrhayaaava| BL:PDB:NREP 1 BL:PDB:REP 20->87|2pq1A|9e-10|42.4|66/134| RP:PDB:NREP 1 RP:PDB:REP 18->126|3dkuD|1e-16|18.3|109/148| RP:PFM:NREP 1 RP:PFM:REP 24->129|PF00293|8e-12|39.6|106/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 19->129|PF00293|3.6e-22|36.0|111/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 18->128|2b06A1|5e-15|21.3|108/150|d.113.1.1| HM:SCP:REP 1->151|1ryaA_|2.6e-25|34.5|148/160|d.113.1.5|1/1|Nudix| OP:NHOMO 25 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1----222-1-1-1-----1------1-2--2221----------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 79.6 SQ:SECSTR EcEEEEHHHHTTcTTEEEEEEEEEEEETTEEEEEEEEccEEEEccEEEccTTccHHHHHHHHHHHHHcccccccEEEEEEEEEcTTccEEEEEEEEEEcccccccccccTTEEEEEEEcHHHHHHcccc################################# DISOP:02AL 1-5,157-163| PSIPRED ccHHHcccccHHcccccEEEEEEEEEcccEEEEEEEcccccEEcccccccccccHHHHHHHHHHHHHccEEEEEEEEEEEcccccccccEEEEEEEEEEcccccccccccHHEEEEEEcHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccc //