[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAG32223.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAG32223.1 GT:GENE BAG32223.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1733376..1733675 GB:FROM 1733376 GB:TO 1733675 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAG32223.1 LENGTH 99 SQ:AASEQ MGMFALGWRDPTSPTAEWDIAQVRRLARRLGYGLLWADSCSVLGLAEQVESSGVGTILLPSSAHVDAVTLDRIMAVADVECAAPRVSFARWSVLGGVRR GT:EXON 1|1-99:0| SEG 24->35|rrlarrlgygll| OP:NHOMO 6 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------6-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,97-100| PSIPRED cccEEEEccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHcccEEEEccHHHcccccHHHHHHHHHHHHcccccHHHHHHHHccccc //