[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAG32224.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 15->79 TSK_RAT 6e-04 32.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAG32224.1 GT:GENE BAG32224.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2124160..2124453 GB:FROM 2124160 GB:TO 2124453 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAG32224.1 LENGTH 97 SQ:AASEQ MDALGWVDPCSPTSEWDAAQVSRLARRLGFEWGWADPCSVLGLVEQVAASGVDAVPLPSTAHVDAVTLDRLMALADVECAAPRRSFARWSSFGGVHR GT:EXON 1|1-97:0| BL:SWS:NREP 1 BL:SWS:REP 15->79|TSK_RAT|6e-04|32.3|65/100| OP:NHOMO 6 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------6-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 94-98| PSIPRED cccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHccccEEEcccHHHHccccHHHHHHHHHHHHcccccHHHHHHHcccccc //