[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAG32225.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:100 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  6->100 1wa8A1 a.25.3.1 * 1.9e-17 35.8 %
:HMM:PFM   9->90 PF06013 * WXG100 4e-15 35.4 82/86  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAG32225.1 GT:GENE BAG32225.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2229336..2229638 GB:FROM 2229336 GB:TO 2229638 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAG32225.1 LENGTH 100 SQ:AASEQ MADDSRDFSFDIDELDQLISRANGFIGFLTESLDGINNRIAAVQQNWQGAAAHAQAEAYQEWVTGAATVVEGLAQMYEAAVTARDAYSAAAEANLRMSGG GT:EXON 1|1-100:0| SEG 44->60|qqnwqgaaahaqaeayq| HM:PFM:NREP 1 HM:PFM:REP 9->90|PF06013|4e-15|35.4|82/86|WXG100| HM:SCP:REP 6->100|1wa8A1|1.9e-17|35.8|95/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,100-101| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //