[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : acpM
DDBJ      :acpM         putative acyl carrier protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  485/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->79 1klpA PDBj 1e-24 90.9 %
:RPS:PDB   5->79 3ejbA PDBj 4e-13 40.0 %
:RPS:SCOP  5->78 1klpA  a.28.1.1 * 3e-15 83.8 %
:HMM:SCOP  2->100 1klpA_ a.28.1.1 * 3.7e-21 35.4 %
:RPS:PFM   19->78 PF00550 * PP-binding 7e-06 40.7 %
:HMM:PFM   13->78 PF00550 * PP-binding 1.2e-18 40.0 65/67  
:HMM:PFM   79->94 PF02370 * M 0.00019 43.8 16/21  
:BLT:SWISS 3->79 ACP_RHOE4 2e-33 84.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56462.1 GT:GENE acpM GT:PRODUCT putative acyl carrier protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1768496..1768795 GB:FROM 1768496 GB:TO 1768795 GB:DIRECTION + GB:GENE acpM GB:PRODUCT putative acyl carrier protein GB:PROTEIN_ID BAD56462.1 LENGTH 99 SQ:AASEQ MAALTQEQIVEELGKIIEEVTGIEPSEVTLEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLASLKTVGDAVAYIQKLEAENADAAAELKAKFDAE GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 3->79|ACP_RHOE4|2e-33|84.4|77/91| SEG 80->98|kleaenadaaaelkakfda| BL:PDB:NREP 1 BL:PDB:REP 25->79|1klpA|1e-24|90.9|55/115| RP:PDB:NREP 1 RP:PDB:REP 5->79|3ejbA|4e-13|40.0|75/78| RP:PFM:NREP 1 RP:PFM:REP 19->78|PF00550|7e-06|40.7|59/67|PP-binding| HM:PFM:NREP 2 HM:PFM:REP 13->78|PF00550|1.2e-18|40.0|65/67|PP-binding| HM:PFM:REP 79->94|PF02370|0.00019|43.8|16/21|M| GO:PFM:NREP 1 GO:PFM GO:0048037|"GO:cofactor binding"|PF00550|IPR006163| RP:SCP:NREP 1 RP:SCP:REP 5->78|1klpA|3e-15|83.8|74/115|a.28.1.1| HM:SCP:REP 2->100|1klpA_|3.7e-21|35.4|99/115|a.28.1.1|1/1|ACP-like| OP:NHOMO 533 OP:NHOMOORG 504 OP:PATTERN -------------------------------------------------------------------- 11111---1111--11111-111111111111111111211212111111111111111111-12111111-----------11111111111-11---1111111111111111111111111111111-1-11-11111---1--------11--111111-11--1-1111111111111-11111112--111111111111111------111111--11-----1---111111111111111111111-1111-11111--11111---------1111211-----------11111111111111--------1112-1111111111112111-----1--111-111111-1--1---1-1-111----11111111111111111111111111112-11111111111--2-11111111111-1-1-1111111111111111-1111111------------1-1111111-11-----111211-----2112121111111221111111121111111121111111111111-1-----1111111-11--111--1----1-11----------------1--1----------11111112111111----------------------------1------1-------------------------------------------------------------------------------------------------1---1111----------------------11-1----1-1111----1----1---111111111----1-------1------------------11111111------------------------------------1211111111--1 ---------------------------------------------------------------11----2--1-2------22222--------1--------111---1-----------------------------------------------------------2---1-1----------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 79.8 SQ:SECSTR ccccccccHHHHHHHHHHHHccccTTTccTTccTTTTTcccTTHHHHHHHHHHHHTTccccHHHHHHcccHHHHHHHHH#################### DISOP:02AL 1-2, 80-93, 97-99| PSIPRED cccccHHHHHHHHHHHHHHHHcccHHHccccccHHHHccccHHHHHHHHHHHHHHccccccHHHHHccccHHHHHHHHHHHcccccccHHHHHHHcccc //