[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : argB
DDBJ      :argB         putative N-acetylglutamate 5-phosphotransferase
Swiss-Prot:ARGB_NOCFA   RecName: Full=Acetylglutamate kinase;         EC=2.7.2.8;AltName: Full=NAG kinase;         Short=AGK;AltName: Full=N-acetyl-L-glutamate 5-phosphotransferase;

Homologs  Archaea  30/68 : Bacteria  552/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
c.73.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->291 2ap9E PDBj 3e-82 68.0 %
:RPS:PDB   4->294 2ap9B PDBj 4e-46 62.3 %
:RPS:SCOP  29->291 1gs5A  c.73.1.2 * 5e-61 22.3 %
:HMM:SCOP  3->294 2bufA1 c.73.1.2 * 2.1e-83 44.6 %
:RPS:PFM   31->264 PF00696 * AA_kinase 7e-06 28.2 %
:HMM:PFM   29->269 PF00696 * AA_kinase 1.2e-42 31.0 226/243  
:BLT:SWISS 1->303 ARGB_NOCFA e-150 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56784.1 GT:GENE argB GT:PRODUCT putative N-acetylglutamate 5-phosphotransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2116220..2117131 GB:FROM 2116220 GB:TO 2117131 GB:DIRECTION + GB:GENE argB GB:PRODUCT putative N-acetylglutamate 5-phosphotransferase GB:PROTEIN_ID BAD56784.1 LENGTH 303 SQ:AASEQ MTAIHSLTALDKAHVLADALPWLQKFRDKIVVVKYGGNAMIDEELKRAFAADMAFLRTVGVHPVVVHGGGPQISAMLKKLGLHGEFRGGFRVTTPEVMDVVRMVLFGQVGRELVGLINAHGPYAVGISGEDAGLFTATRRTVVVDGEPTDIGLVGDVTEVNPDAVLDLIGAGRIPVVSTIAPDADGVVHNINADTAAAALAEGIGAEKLVVLTDVEGLYTNWPDRSSLTSSIDAGALAELLPRLDAGMVPKMEACLRAVRGGVPTAHVIDGRVPHAVLLELFTGEGIGTMVTPSAASDGVVPA GT:EXON 1|1-303:0| SW:ID ARGB_NOCFA SW:DE RecName: Full=Acetylglutamate kinase; EC=2.7.2.8;AltName: Full=NAG kinase; Short=AGK;AltName: Full=N-acetyl-L-glutamate 5-phosphotransferase; SW:GN Name=argB; OrderedLocusNames=NFA_19380; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; ATP-binding;Complete proteome; Cytoplasm; Kinase; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->303|ARGB_NOCFA|e-150|100.0|303/303| GO:SWS:NREP 7 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 59->71|vgvhpvvvhgggp| SEG 190->207|ninadtaaaalaegigae| BL:PDB:NREP 1 BL:PDB:REP 4->291|2ap9E|3e-82|68.0|281/288| RP:PDB:NREP 1 RP:PDB:REP 4->294|2ap9B|4e-46|62.3|284/285| RP:PFM:NREP 1 RP:PFM:REP 31->264|PF00696|7e-06|28.2|227/244|AA_kinase| HM:PFM:NREP 1 HM:PFM:REP 29->269|PF00696|1.2e-42|31.0|226/243|AA_kinase| GO:PFM:NREP 1 GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF00696|IPR001048| RP:SCP:NREP 1 RP:SCP:REP 29->291|1gs5A|5e-61|22.3|251/259|c.73.1.2| HM:SCP:REP 3->294|2bufA1|2.1e-83|44.6|289/0|c.73.1.2|1/1|Carbamate kinase-like| OP:NHOMO 688 OP:NHOMOORG 607 OP:PATTERN ---1-------------1-----11----1-11111111111111111111111------------11 1111211111111111111-111111111111111111111111111-1111111111--111111111111111111--11-11111111111----1--1-1111111---------------1111111111121111111-111111111111111111111111111111111111112211111-11111111111-1111111111111111111111-1-11111-------------------1-------1------------11-111----------------------------------1---------11-11-------1-111111---1-1--111111111111-111111--1121111111111111111111111111111111111-11111111111-1111111111111111-1111111111111111111111111111111111-----------------111111111111111222222222222221222222222111211222212111222112212222221111111221112-11111111111111111111111222212111-11111111--1-------1111122-1--111----------11--------------2112--------11--1---------------------------------11--1---------------------------------------------------111122111--2--------111111211111111111111111111111--------1211------1-1--11-1-11-------1111111111-------------------------------------11--11111121 -------------------------------------------------------------------------------------------------------111--2------------------------------------------------------------------11117111112254-11111-1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 97.4 SQ:SECSTR ###cTTccHHHHHHHHHTTHHHHHHHTTcEEEEEEcTHHHccHHHHHHHHHHHHHHHTTTcEEEEEEcccHHHHHHHHHTTcccccccccccccHHHHHHHHHHHHHTHHHHHHHHHTTccccEEEEETTGGGcEEEEEccccccccccccccEEEEEEEcHHHHHHHHHTTcEEEEEcEEccTTcccEEEcHHHHHHHHHHHTTccEEEEEEcccccccccccTTccccEEETTTTGGGGcGGccTTHHHHHHHHHHHTTTccEEEEEETTcTTHHHHHHHccccccEEEEcccEEE##### DISOP:02AL 297-303| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccEEccHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccHHHHccccccEEEEcccccccccccccccccHHHHHHHHHcccEEEEccccccccccEEEccHHHHHHHHHHHHcccEEEEEEcccHHcccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHcccccEEEEEcccHHcccccc //