[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : argH
DDBJ      :argH         putative argininosuccinate lyase
Swiss-Prot:ARLY_NOCFA   RecName: Full=Argininosuccinate lyase;         Short=ASAL;         EC=4.3.2.1;AltName: Full=Arginosuccinase;

Homologs  Archaea  52/68 : Bacteria  751/915 : Eukaryota  168/199 : Viruses  0/175   --->[See Alignment]
a.127.1
:473 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->450 1k62B PDBj 1e-62 34.9 %
:RPS:PDB   20->450 2e9fB PDBj 2e-71 35.3 %
:RPS:SCOP  31->450 1aosA  a.127.1.1 * 1e-56 35.2 %
:HMM:SCOP  15->469 1i0aA_ a.127.1.1 * 4.9e-132 41.1 %
:RPS:PFM   115->309 PF00206 * Lyase_1 3e-13 29.7 %
:HMM:PFM   22->310 PF00206 * Lyase_1 1.6e-69 34.9 289/312  
:BLT:SWISS 1->473 ARLY_NOCFA e-178 100.0 %
:PROS 285->294|PS00163|FUMARATE_LYASES
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56809.1 GT:GENE argH GT:PRODUCT putative argininosuccinate lyase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2136287..2137708 GB:FROM 2136287 GB:TO 2137708 GB:DIRECTION + GB:GENE argH GB:PRODUCT putative argininosuccinate lyase GB:PROTEIN_ID BAD56809.1 LENGTH 473 SQ:AASEQ MTQSGGTNTGALWGGRFASGPAAAMAALSKSTHFDWALAPYDIRASKAHARVLHKAGLLSDADLDTMLAGLDGLAADVASGAFVPAETDEDVHGALERGLIDRVGAEVGGRLRAGRSRNDQVATLFRMWLRDGVRRVAAGVLDVVDALVEQAAAHPDAVMPGKTHLQAAQPVLLAHHLLAHAHPLLRDIERLRDFDKRAAVSPYGSGALAGSSLGLDPEAIAADLDFDAAAANSIDATSARDFAAEAAFVLAMIAVDLSRMAEEVIIWSTPEFGYVTLADAWSTGSSIMPQKKNPDVSELTRGKAGRLIGNLTGLLATLKAQPLAYNRDLQEDKEPVFDSVAQLELLLPAIAGLVGTLTFHTDRMAELAPAGFTLATDIAEWLVREGVPFRVAHEAAGACVRAAEARGVGLDALTDEEFAAIDPALTPRVREVLTVQGSIASRNAKGGTAGTRVAEQLAEVRAAAQQARAWIA GT:EXON 1|1-473:0| SW:ID ARLY_NOCFA SW:DE RecName: Full=Argininosuccinate lyase; Short=ASAL; EC=4.3.2.1;AltName: Full=Arginosuccinase; SW:GN Name=argH; OrderedLocusNames=NFA_19630; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; Complete proteome;Cytoplasm; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->473|ARLY_NOCFA|e-178|100.0|473/473| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| PROS 285->294|PS00163|FUMARATE_LYASES|PDOC00147| SEG 22->27|aaamaa| SEG 61->82|dadldtmlagldglaadvasga| SEG 133->149|gvrrvaagvldvvdalv| SEG 165->186|hlqaaqpvllahhllahahpll| SEG 205->216|gsgalagsslgl| SEG 220->240|aiaadldfdaaaansidatsa| SEG 392->410|vaheaagacvraaeargvg| SEG 453->470|rvaeqlaevraaaqqara| BL:PDB:NREP 1 BL:PDB:REP 10->450|1k62B|1e-62|34.9|439/459| RP:PDB:NREP 1 RP:PDB:REP 20->450|2e9fB|2e-71|35.3|430/450| RP:PFM:NREP 1 RP:PFM:REP 115->309|PF00206|3e-13|29.7|195/302|Lyase_1| HM:PFM:NREP 1 HM:PFM:REP 22->310|PF00206|1.6e-69|34.9|289/312|Lyase_1| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00206|IPR000362| RP:SCP:NREP 1 RP:SCP:REP 31->450|1aosA|1e-56|35.2|409/434|a.127.1.1| HM:SCP:REP 15->469|1i0aA_|4.9e-132|41.1|453/453|a.127.1.1|1/1|L-aspartase-like| OP:NHOMO 1087 OP:NHOMOORG 971 OP:PATTERN ---1--1111111111-11111-1111111111111111111111111111111-1-----1--1-11 1111111111111111111-11111111111111111111111111111111111111--112111111111111111--11111111111111---111-1-1111111---------------11111111111111111111111111111111111111111111111111111111111111111-11122222112122211221111122211121111111112111111111111111111111----11-1---111111-1-11-111111----111-11--11--1--------------111111111111-1111111111111111111-1111-2111111111-11111111--1111111111--1-11111111111111111111112-1111111162111111111111222411111122121111111111111111111---11111---------------------11111112211211112111111111333331111121211111111111131121111111111111111111111-111111111111111111111111111111111111111111-1-------1111111111111111111111111111111111111---111111111111211111111111111-1111211111111111111111111111111111111111111111111111-111111111111---1-----111111111111111111111111111111111111111111211111111111--------121111111111111111111111111111111111111-------------------------------------11--11-11111 ------1-----111-111111111111111-11111111111111111112131111111111111111111111111112111111-11111111111111111-12-2131123111111111-217A4-413---111111----111--152-212-121112112--11111181111121221111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 441 STR:RPRED 93.2 SQ:SECSTR #########TccccHGGccccHHHHHHHHccHHHHGGGHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHTTcccccGGGccHHHHHHHHHHHHHcGGGGGGTTTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcEEEEEETTEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcEEcTTcTTcccccccccHHHHHHHTTccEEcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTTTccEEccGGGcccccccccccccHHHHHHHHTHHHHHHHHHHHHHHHTTccccccGGGGGGHHHHHHHHHHHHHHHHHHHHHGGGcEEcHHHHHHHHccccTTHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHTTccGGGccHHHHHHHcTTccGGGGGGccHHHHGGGcccTTccc####################### DISOP:02AL 1-11| PSIPRED cccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHcHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccc //