[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : argJ
DDBJ      :argJ         putative glutamate N-acetyltransferase
Swiss-Prot:ARGJ_NOCFA   RecName: Full=Arginine biosynthesis bifunctional protein argJ;Includes:  RecName: Full=Glutamate N-acetyltransferase;           EC=2.3.1.35;  AltName: Full=Ornithine acetyltransferase;           Short=OATase;  AltName: Full=Ornithine transacetylase;Includes:  RecName: Full=Amino-acid acetyltransferase;           EC=2.3.1.1;  AltName: Full=N-acetylglutamate synthase;           Short=AGS;Contains:  RecName: Full=Arginine biosynthesis bifunctional protein argJ alpha chain;Contains:  RecName: Full=Arginine biosynthesis bifunctional protein argJ beta chain;

Homologs  Archaea  23/68 : Bacteria  524/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
d.154.1
:405 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->401 1vz6A PDBj 4e-37 31.7 %
:RPS:PDB   38->343 2drhB PDBj 2e-44 14.9 %
:RPS:SCOP  20->401 1vz6A  d.154.1.2 * 1e-83 30.1 %
:HMM:SCOP  19->402 1vz6A_ d.154.1.2 * 2.7e-125 51.9 %
:RPS:PFM   38->403 PF01960 * ArgJ 1e-75 50.6 %
:HMM:PFM   23->405 PF01960 * ArgJ 1.2e-127 48.0 375/388  
:BLT:SWISS 1->405 ARGJ_NOCFA 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56783.1 GT:GENE argJ GT:PRODUCT putative glutamate N-acetyltransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2115006..2116223 GB:FROM 2115006 GB:TO 2116223 GB:DIRECTION + GB:GENE argJ GB:PRODUCT putative glutamate N-acetyltransferase GB:PROTEIN_ID BAD56783.1 LENGTH 405 SQ:AASEQ MTTTDSGTGKLVRTQGVTAPLGFRAAGIAAGIKASGKPDLALVFNEGPEYAAAGVFTRNKVKAAPVLWSQQVLTSRRLRAVILNSGGANACTGPEGFQDTHRTAEELARALSNWGTETGAGEIAVCSTGLIGDRLPMDKLIPAVTEIVHEMGGGLSGGTDAAHAIMTTDTVPKEAAFHHRDKWNVGGMAKGAGMLAPSLATMLVVLTTDAAVTAEQLDTALRKATRLTFDRLDVDGSCSTNDTVLLLANGASEVTPSQEELEAAVFAVCDDLAAQLMADAEGVTKRVRVTVTGAANEDEAVTAARAIARDSLVKTALFGSDPNWGRVLAAVGIAPITLDPDRISVSFNGNPVCVNGVGAPGARQVDLSGADIDVLVELNVGDGEAMIRTTDLSHGYVEENSAYSS GT:EXON 1|1-405:0| SW:ID ARGJ_NOCFA SW:DE RecName: Full=Arginine biosynthesis bifunctional protein argJ;Includes: RecName: Full=Glutamate N-acetyltransferase; EC=2.3.1.35; AltName: Full=Ornithine acetyltransferase; Short=OATase; AltName: Full=Ornithine transacetylase;Includes: RecName: Full=Amino-acid acetyltransferase; EC=2.3.1.1; AltName: Full=N-acetylglutamate synthase; Short=AGS;Contains: RecName: Full=Arginine biosynthesis bifunctional protein argJ alpha chain;Contains: RecName: Full=Arginine biosynthesis bifunctional protein argJ beta chain; SW:GN Name=argJ; OrderedLocusNames=NFA_19370; SW:KW Acyltransferase; Amino-acid biosynthesis; Arginine biosynthesis;Complete proteome; Cytoplasm; Multifunctional enzyme; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->405|ARGJ_NOCFA|0.0|100.0|405/405| GO:SWS:NREP 6 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 25->37|aagiaagikasgk| SEG 283->292|vtkrvrvtvt| BL:PDB:NREP 1 BL:PDB:REP 39->401|1vz6A|4e-37|31.7|350/376| RP:PDB:NREP 1 RP:PDB:REP 38->343|2drhB|2e-44|14.9|275/353| RP:PFM:NREP 1 RP:PFM:REP 38->403|PF01960|1e-75|50.6|358/388|ArgJ| HM:PFM:NREP 1 HM:PFM:REP 23->405|PF01960|1.2e-127|48.0|375/388|ArgJ| GO:PFM:NREP 2 GO:PFM GO:0004358|"GO:glutamate N-acetyltransferase activity"|PF01960|IPR002813| GO:PFM GO:0006526|"GO:arginine biosynthetic process"|PF01960|IPR002813| RP:SCP:NREP 1 RP:SCP:REP 20->401|1vz6A|1e-83|30.1|372/376|d.154.1.2| HM:SCP:REP 19->402|1vz6A_|2.7e-125|51.9|374/383|d.154.1.2|1/1|DmpA/ArgJ-like| OP:NHOMO 697 OP:NHOMOORG 664 OP:PATTERN -----------------------1--------1111111111111111111111-------------- 1-11111111111111111-111111111111111111111112111-1111111111--111112111111111111--21111111-------------------------------------11111111111222221111-11111111111111111111122111111111111111111111--211111111111111111111111111111111111111-1-11111111111111-11-1-------1---11-------11-111-------111------------------------1--111-----1-21-------1-111111---1-1--111111111111-11111---1111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111---11111---------------------11111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111112222-1111-111-------1-------1111111----111--------------------------1111------------------------------------------------------------------------------------------------------11111---------------111111111111111111111111111111--------1----------------------------1112111111-------------------------------------11--11111111 ----11--------1-1111111111111111111111111111112211111111111111111111111111111-1111111111-12111111111111111-11-------------------------------------------------------------1----11118111112131111111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 390 STR:RPRED 96.3 SQ:SECSTR ###############cEEEEEEEEcccccTTcccccEEEEEEEEcccccTTTEEEEEEEcccccccHHHHHHHcEEcHccEEEEEGGGHHHHHHHHHHHHHHHcTTcTTTcccccccEEEEEEEEEccTTTccGGGccccHHHHHHEETTEEcEEEEEEEEEEETTEEEEEEEEEEcccGGGcccTTccHHHHTTTcccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHTTccccTTccEEEEEEEEEEEEETTcccccccccGGcccccccccccGGGcHHHHHcccTTcccTHHHHHHHHHHHHHHHHHcccEEcGGTccGcEEccccHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHTcHHGGGTHHHHHccccEEEEEEEEcccHHHHHHHHHccc DISOP:02AL 1-3| PSIPRED cccEEcEEEEEEEcccccccccEEEEEEEEEEccccccEEEEEEEcccccEEEEEEcccccccccHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccccHHcEEEEEcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHEEcccccccEEEEEEccEEEEEEEEEccccccccHHHEEEEEEEcccccHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccHHHHHHHHHHHHcccHHHHHHccccccHHHHHHHHccccccccccEEEEEEccEEEEccccccHHHHHHHHccccEEEEEEEEcccEEEEEEEEcccHHHEEEcccccc //