[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : atpE
DDBJ      :atpE         putative ATP synthase C subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.17.1
:81 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   48->81 1wu0A PDBj 4e-07 52.9 %
:RPS:SCOP  48->81 1ijpA  f.17.1.1 * 2e-07 32.4 %
:HMM:SCOP  12->83 1c99A_ f.17.1.1 * 1.9e-15 50.0 %
:HMM:PFM   21->81 PF00137 * ATP-synt_C 1.9e-21 49.1 57/66  
:BLT:SWISS 48->81 ATPL_CLAMS 8e-10 73.5 %
:PROS 47->68|PS00605|ATPASE_C
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55905.1 GT:GENE atpE GT:PRODUCT putative ATP synthase C subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1170089..1170334 GB:FROM 1170089 GB:TO 1170334 GB:DIRECTION + GB:GENE atpE GB:PRODUCT putative ATP synthase C subunit GB:PROTEIN_ID BAD55905.1 LENGTH 81 SQ:AASEQ MSLSYLAQEAANESTLKGLGAVGYGLAAIGPGIGVGIVVGKAIEGIARQPELQGTIRTNMFLGIAFTEALALIGLVAGFIF GT:EXON 1|1-81:0| BL:SWS:NREP 1 BL:SWS:REP 48->81|ATPL_CLAMS|8e-10|73.5|34/77| PROS 47->68|PS00605|ATPASE_C|PDOC00526| TM:NTM 2 TM:REGION 20->42| TM:REGION 57->79| SEG 25->47|glaaigpgigvgivvgkaiegia| BL:PDB:NREP 1 BL:PDB:REP 48->81|1wu0A|4e-07|52.9|34/72| HM:PFM:NREP 1 HM:PFM:REP 21->81|PF00137|1.9e-21|49.1|57/66|ATP-synt_C| RP:SCP:NREP 1 RP:SCP:REP 48->81|1ijpA|2e-07|32.4|34/79|f.17.1.1| HM:SCP:REP 12->83|1c99A_|1.9e-15|50.0|72/79|f.17.1.1|1/1|F1F0 ATP synthase subunit C| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -----111111111----------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 34 STR:RPRED 42.0 SQ:SECSTR ###############################################TccTTTTHHHHHHHHHHHHHTHHHHHHHHHHHHH PSIPRED ccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //