[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : atpF
DDBJ      :atpF         putative ATP synthase B subunit
Swiss-Prot:ATPF_NOCFA   RecName: Full=ATP synthase subunit b;AltName: Full=ATP synthase F(0) sector subunit b;AltName: Full=F-type ATPase subunit b;         Short=F-ATPase subunit b;AltName: Full=ATPase subunit I;

Homologs  Archaea  0/68 : Bacteria  110/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.23.21
:186 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  85->139 1l2pA  f.23.21.1 * 5e-04 41.8 %
:HMM:SCOP  80->140 1l2pA_ f.23.21.1 * 2.5e-13 37.7 %
:RPS:PFM   27->154 PF00430 * ATP-synt_B 3e-07 28.9 %
:HMM:PFM   26->155 PF00430 * ATP-synt_B 1.5e-31 31.5 130/132  
:BLT:SWISS 1->186 ATPF_NOCFA 1e-84 100.0 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55906.1 GT:GENE atpF GT:PRODUCT putative ATP synthase B subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1170340..1170900 GB:FROM 1170340 GB:TO 1170900 GB:DIRECTION + GB:GENE atpF GB:PRODUCT putative ATP synthase B subunit GB:PROTEIN_ID BAD55906.1 LENGTH 186 SQ:AASEQ MYEYSVLAAESGEDVNPLIPATYDIVWSVVCVAIIAVVFYKYVIPRLTKVLNERADKIEGGIAKAEAAQAEAQQTLEQYQQQLADARLEAARIREDARTQGQQILAQMRAEAQAESDRIVAAGHAQLEAQRQQILTELRSEVGRTAVDLAEKIIGQSVSDEAKQAASIERFLSELDSSDAGIGVGR GT:EXON 1|1-186:0| SW:ID ATPF_NOCFA SW:DE RecName: Full=ATP synthase subunit b;AltName: Full=ATP synthase F(0) sector subunit b;AltName: Full=F-type ATPase subunit b; Short=F-ATPase subunit b;AltName: Full=ATPase subunit I; SW:GN Name=atpF; OrderedLocusNames=NFA_10610; SW:KW ATP synthesis; Cell membrane; CF(0); Complete proteome;Hydrogen ion transport; Ion transport; Membrane; Transmembrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->186|ATPF_NOCFA|1e-84|100.0|186/186| GO:SWS:NREP 8 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|CF(0)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| COIL:NAA 47 COIL:NSEG 1 COIL:REGION 59->105| TM:NTM 1 TM:REGION 24->46| SEG 63->84|akaeaaqaeaqqtleqyqqqla| RP:PFM:NREP 1 RP:PFM:REP 27->154|PF00430|3e-07|28.9|128/132|ATP-synt_B| HM:PFM:NREP 1 HM:PFM:REP 26->155|PF00430|1.5e-31|31.5|130/132|ATP-synt_B| GO:PFM:NREP 3 GO:PFM GO:0015078|"GO:hydrogen ion transmembrane transporter activity"|PF00430|IPR002146| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00430|IPR002146| GO:PFM GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|PF00430|IPR002146| RP:SCP:NREP 1 RP:SCP:REP 85->139|1l2pA|5e-04|41.8|55/61|f.23.21.1| HM:SCP:REP 80->140|1l2pA_|2.5e-13|37.7|61/61|f.23.21.1|1/1|F1F0 ATP synthase subunit B, membrane domain| OP:NHOMO 110 OP:NHOMOORG 110 OP:PATTERN -------------------------------------------------------------------- ----1111111111---11-11----11111--1111111111111111-11111111111111111111-1111111----------1111----------1------1----------------------1-----------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----------------------------1111---11-11--1111-11-----111-----1-----------------------------------------------------------------------------------------------------------1------1111-----11-------1---1-1111-----------------------111------1-1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 180-181| PSIPRED cccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccc //