[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : birA
DDBJ      :birA         putative biotin-[acetyl-CoA carboxylase] holoenzyme synthetase/biotin operon repressor
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  474/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.34.1d.104.1
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->269 2cghB PDBj 1e-29 43.2 %
:RPS:PDB   11->269 2cghA PDBj 7e-43 40.8 %
:RPS:SCOP  33->223 1wnlA2  d.104.1.2 * 1e-28 26.3 %
:RPS:SCOP  227->270 1biaA2  b.34.1.1 * 5e-07 35.7 %
:HMM:SCOP  17->225 1biaA3 d.104.1.2 * 6.3e-53 38.0 %
:RPS:PFM   58->145 PF03099 * BPL_LplA_LipB 4e-11 45.8 %
:HMM:PFM   50->162 PF03099 * BPL_LplA_LipB 1.6e-24 37.0 108/125  
:HMM:PFM   227->257 PF02237 * BPL_C 1.1e-08 46.7 30/48  
:HMM:PFM   194->234 PF09929 * DUF2161 0.0002 26.8 41/118  
:BLT:SWISS 36->256 BIRA_BACSU 3e-21 33.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55840.1 GT:GENE birA GT:PRODUCT putative biotin-[acetyl-CoA carboxylase] holoenzyme synthetase/biotin operon repressor GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1102153..1102974 GB:FROM 1102153 GB:TO 1102974 GB:DIRECTION + GB:GENE birA GB:PRODUCT putative biotin-[acetyl-CoA carboxylase] holoenzyme synthetase/biotin operon repressor GB:PROTEIN_ID BAD55840.1 LENGTH 273 SQ:AASEQ MQSPSSDASRRPPLDVTRLRRGVESPELSLFSRVAVVEATGSTNADLIARASDPGAAGTVLLAETQQAGRGRHARSWTSPPRAQIAMSMLVRPRGLEPAVLGWLPLLTGVAVVDALRAAAGVPAELKWPNDVLIGGRKVAGILAEVAASGGTPAVVVGVGVNVSLSAAELPVPHAISLELAGAAQVDRTAVVLAILAEFSRRFDAWRQAGWDTTELAAAYRERCATIGAQVMAELPGGRTLTGIATGIDDAGRLLIGDDAVSAGDVTHLRGQY GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 36->256|BIRA_BACSU|3e-21|33.6|214/325| SEG 146->168|vaasggtpavvvgvgvnvslsaa| BL:PDB:NREP 1 BL:PDB:REP 11->269|2cghB|1e-29|43.2|234/242| RP:PDB:NREP 1 RP:PDB:REP 11->269|2cghA|7e-43|40.8|233/238| RP:PFM:NREP 1 RP:PFM:REP 58->145|PF03099|4e-11|45.8|83/118|BPL_LplA_LipB| HM:PFM:NREP 3 HM:PFM:REP 50->162|PF03099|1.6e-24|37.0|108/125|BPL_LplA_LipB| HM:PFM:REP 227->257|PF02237|1.1e-08|46.7|30/48|BPL_C| HM:PFM:REP 194->234|PF09929|0.0002|26.8|41/118|DUF2161| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF03099|IPR004143| GO:PFM GO:0006464|"GO:protein modification process"|PF03099|IPR004143| RP:SCP:NREP 2 RP:SCP:REP 33->223|1wnlA2|1e-28|26.3|175/188|d.104.1.2| RP:SCP:REP 227->270|1biaA2|5e-07|35.7|42/47|b.34.1.1| HM:SCP:REP 17->225|1biaA3|6.3e-53|38.0|205/207|d.104.1.2|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 520 OP:NHOMOORG 506 OP:PATTERN --1-------------1------11-1-1-111-111------112--11111-1111111-----11 111-111111111111111-11111111111111111111111111-1111111111111111111111111111111----1---11------111-----------11---------------111111111-1111111111--------11--------1--11-1---------------1--11--111111111111111111111211111111-1-11111111----------------11----1--------11--1111--1------------11-----------------------------------11-1-------1-11111111-111--1111-11111-11111111---12----1-----1111111111-2-11111111111-11111-1-111-111-11111111-1-1-----1---1-------------1-1111---111-----1111--1-----------11111-----11-1-------111-------11-----------11111--1111---1-11--------1111---111--1-11111-11111111111111112---------------------------1111111-1111111111111-111111-----11--------11--1111111111111-1111111111111111111111--111111111111111111111111111--1111111111111-1-11111----1-1-1---11111111---1----------1111111111111111111----------11111111111--1-----------1-1------------------1----------------------------1---111-1-2- ----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------6------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 261 STR:RPRED 95.6 SQ:SECSTR ##########cccccHHHHHHHHccTTcccccEEEEEcccccHHHHHHHHHTTccccTEEEEEcccccTTcEEEEEEEEEcTTccGGGTTHHHHHHHHHHHHHHGGGccccGGGEHTTTccccEEEETTTEEEETTEEEEEEEEEEETTEEEEEEEEEccccccGGGGGccccccccTGGGTcccccHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTcccTTcEEEEEETTTEEEEEEEEEEcTTccEEEEETEEcccccEEccE## DISOP:02AL 1-10| PSIPRED cccccccccccccccHHHHHHHHcccccccccEEEEEEccccHHHHHHHHHHcccccccEEEEccccccccccccEEEEcccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccEEEEccEEEEEEEEEEEEccccEEEEEEEEEEcccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEcccEEEEEEEEEEccccEEEEEEccEEEcEEEEEEEEc //