[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : clp3
DDBJ      :clp3         putative Clp protease proteolytic subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  883/915 : Eukaryota  140/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:201 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->184 2cbyG PDBj 3e-38 48.4 %
:RPS:PDB   18->185 2cbyB PDBj 5e-38 48.1 %
:RPS:SCOP  16->186 1tg6A1  c.14.1.1 * 4e-22 32.7 %
:HMM:SCOP  4->194 2f6iA1 c.14.1.1 * 8e-54 38.4 %
:RPS:PFM   17->185 PF00574 * CLP_protease 6e-39 44.4 %
:HMM:PFM   16->185 PF00574 * CLP_protease 8.3e-55 41.8 170/182  
:BLT:SWISS 16->186 CLPP1_CORJK 4e-47 50.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56016.1 GT:GENE clp3 GT:PRODUCT putative Clp protease proteolytic subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1298680..1299285 GB:FROM 1298680 GB:TO 1299285 GB:DIRECTION + GB:GENE clp3 GB:PRODUCT putative Clp protease proteolytic subunit GB:PROTEIN_ID BAD56016.1 LENGTH 201 SQ:AASEQ MAHDDKTPLFGWRAREQLLSRRILVLDGPLDDDNGTLLATQLLTLAAENDEAPISLWIHSPGGSVPAMLAIRDVMRLVPCEVSTLALGLACSAGQFLLSAGSRGKRFALPHARVLMHQGSAGIGGTAVDVEVQADDLRHTVETVLGLIAADTGQPYDRIYEDSLHDRWFTAAQAKEYGFIDHIVDSFGQVVPQRPRVGITL GT:EXON 1|1-201:0| BL:SWS:NREP 1 BL:SWS:REP 16->186|CLPP1_CORJK|4e-47|50.9|171/188| SEG 36->47|tllatqlltlaa| BL:PDB:NREP 1 BL:PDB:REP 16->184|2cbyG|3e-38|48.4|159/167| RP:PDB:NREP 1 RP:PDB:REP 18->185|2cbyB|5e-38|48.1|158/170| RP:PFM:NREP 1 RP:PFM:REP 17->185|PF00574|6e-39|44.4|169/179|CLP_protease| HM:PFM:NREP 1 HM:PFM:REP 16->185|PF00574|8.3e-55|41.8|170/182|CLP_protease| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF00574|IPR001907| GO:PFM GO:0006508|"GO:proteolysis"|PF00574|IPR001907| RP:SCP:NREP 1 RP:SCP:REP 16->186|1tg6A1|4e-22|32.7|171/184|c.14.1.1| HM:SCP:REP 4->194|2f6iA1|8e-54|38.4|190/0|c.14.1.1|1/1|ClpP/crotonase| OP:NHOMO 1664 OP:NHOMOORG 1023 OP:PATTERN -------------------------------------------------------------------- 1112422222222222222-222222222222222244442445442222222222242233423225532222222211121111111111111111-11112211122222222222222222111111111112222211111344344433444444444432444444444444444411111112211222222222233222222211222111111122222233211111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111112111111112112111111211112111122111111111111111112111211111112211111111111111111112-1121111122213332332333331122111211111112222222222221121111111111111111111111111111111111111111211111111111112211111121211111111111111211121111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111221111111111--1111111111111111111111111111111111111111112111111111111111111111111111111111121211111111111111111111111111111222211111111111111111111111111111111111111211111111111111112222222222222222--------------------------1111111111121 22----122---1111111111111111111111111111111-11111111111111111-1----------1---------------1211111111111-111-1C-21111211-1--1-1-1--151-1-1-1--11111-1---1---1--111111111-111512125656*78849JAKG19C6631116 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 92.5 SQ:SECSTR #######ccccccEEEEHHHTTEEEEcccccHHHHHHHHHHHHHHHHHcTTccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEETHHHHHHHTccTTcEEEcTTcEEEccccGGcccccccccHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHTTcEEEHHHHHHHTcccEEcccHHHHHHH######## DISOP:02AL 1-6, 200-201| PSIPRED cccccccccccccHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccccEEEccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHcccHHHHHHcHHHcccccccccccc //