[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : clpP1
DDBJ      :clpP1        putative Clp protease proteolytic subunit
Swiss-Prot:CLPP2_NOCFA  RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;         EC=3.4.21.92;AltName: Full=Endopeptidase Clp 2;

Homologs  Archaea  0/68 : Bacteria  884/915 : Eukaryota  144/199 : Viruses  1/175   --->[See Alignment]
c.14.1
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->196 2cbyD PDBj 4e-66 70.0 %
:RPS:PDB   17->196 2cbyB PDBj 5e-60 70.0 %
:RPS:SCOP  22->192 1tg6A1  c.14.1.1 * 2e-33 43.9 %
:HMM:SCOP  12->202 2f6iA1 c.14.1.1 * 1.2e-68 52.1 %
:RPS:PFM   15->192 PF00574 * CLP_protease 3e-55 57.1 %
:HMM:PFM   21->193 PF00574 * CLP_protease 1.3e-78 57.8 173/182  
:BLT:SWISS 1->203 CLPP2_NOCFA e-105 100.0 %
:PROS 114->127|PS00382|CLP_PROTEASE_HIS
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56178.1 GT:GENE clpP1 GT:PRODUCT putative Clp protease proteolytic subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1492491..1493102 GB:FROM 1492491 GB:TO 1493102 GB:DIRECTION + GB:GENE clpP1 GB:PRODUCT putative Clp protease proteolytic subunit GB:PROTEIN_ID BAD56178.1 LENGTH 203 SQ:AASEQ MTKNQAGVMTSATAGLNLSDSVYERLLRERIIFLGTQVDDDIANKLCAQILLLSAEDPTRDISLYINSPGGSVTAGMAIYDTMQFAECDIRTVGMGLAASMGQFLLTAGTKGKRYALPHARIMMHQPSAGIGGSAADIAIMAEQFAHTKRELNELQALHTGKSVEQVTADADRDRWFTAQEALEYGFIDHVISHANQANGIGG GT:EXON 1|1-203:0| SW:ID CLPP2_NOCFA SW:DE RecName: Full=ATP-dependent Clp protease proteolytic subunit 2; EC=3.4.21.92;AltName: Full=Endopeptidase Clp 2; SW:GN Name=clpP2; OrderedLocusNames=NFA_13330; SW:KW ATP-binding; Complete proteome; Cytoplasm; Hydrolase;Nucleotide-binding; Protease; Serine protease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->203|CLPP2_NOCFA|e-105|100.0|203/203| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0008236|"GO:serine-type peptidase activity"|Serine protease| PROS 114->127|PS00382|CLP_PROTEASE_HIS|PDOC00358| SEG 129->142|agiggsaadiaima| BL:PDB:NREP 1 BL:PDB:REP 17->196|2cbyD|4e-66|70.0|170/171| RP:PDB:NREP 1 RP:PDB:REP 17->196|2cbyB|5e-60|70.0|170/170| RP:PFM:NREP 1 RP:PFM:REP 15->192|PF00574|3e-55|57.1|177/179|CLP_protease| HM:PFM:NREP 1 HM:PFM:REP 21->193|PF00574|1.3e-78|57.8|173/182|CLP_protease| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF00574|IPR001907| GO:PFM GO:0006508|"GO:proteolysis"|PF00574|IPR001907| RP:SCP:NREP 1 RP:SCP:REP 22->192|1tg6A1|2e-33|43.9|171/184|c.14.1.1| HM:SCP:REP 12->202|2f6iA1|1.2e-68|52.1|190/0|c.14.1.1|1/1|ClpP/crotonase| OP:NHOMO 1693 OP:NHOMOORG 1029 OP:PATTERN -------------------------------------------------------------------- 1112422222222222222-222222222222222244442445442222222222242233423225532222222211121111111111111121-11112211122222222222222222111111111112222211111344344433444444444432444444444444444411111112211222222222233222222211222111111122222233211111111111111111111111111111111111111111111112111111111111111111111111111111111-111111111111211111111211211111121111211112211111111111111111211121111111221111111111111111111211121111122213332332333331122111211111112222222222221121111111111111111111111111111111111111111211111111111112211111121211111111111111211122111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111221111111111--1111111111111111111111111111111111111111112111111111111111111111111111111111121211111111111111111111111111111222311111111111111111111111111111111111111211111111111111112222222222222222--------------------------1111111111121 22----122---1111111111111111111111111111111-11111111111111111-1----------1---------------1211111111111-111-1D-21111211-1--111-11-151-1-111--11111-1--11---1--111111211-111512225766*78969JCKK19C6631117 ----------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 97.5 SQ:SECSTR EEcEEEGGGccccccccHHHHHHHHHHHTTEEEEcccccHHHHHHHHHHHHHHHHHcTTccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEETHHHHHHHTccTTcEEEcTTcEEEcccccccTTccccHcHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHTTcEEEHHHHHHHTcccEEcccccHH##### DISOP:02AL 195-203| PSIPRED cccccccEEEEcccccccHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHccccccEEEccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHccHHHHHccccccccccc //