[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : clpP2
DDBJ      :clpP2        putative Clp protease proteolytic subunit
Swiss-Prot:CLPP3_NOCFA  RecName: Full=ATP-dependent Clp protease proteolytic subunit 3;         EC=3.4.21.92;AltName: Full=Endopeptidase Clp 3;

Homologs  Archaea  0/68 : Bacteria  883/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:221 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->215 1yg6B PDBj 1e-49 47.1 %
:RPS:PDB   41->213 2cbyB PDBj 9e-50 44.1 %
:RPS:SCOP  41->215 1tg6A1  c.14.1.1 * 5e-26 41.0 %
:HMM:SCOP  30->222 2f6iA1 c.14.1.1 * 1.3e-67 50.5 %
:RPS:PFM   41->213 PF00574 * CLP_protease 1e-52 55.6 %
:HMM:PFM   39->213 PF00574 * CLP_protease 2.4e-76 56.6 173/182  
:BLT:SWISS 1->221 CLPP3_NOCFA e-117 100.0 %
:PROS 110->121|PS00381|CLP_PROTEASE_SER
:PROS 132->145|PS00382|CLP_PROTEASE_HIS
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56179.1 GT:GENE clpP2 GT:PRODUCT putative Clp protease proteolytic subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1493162..1493827 GB:FROM 1493162 GB:TO 1493827 GB:DIRECTION + GB:GENE clpP2 GB:PRODUCT putative Clp protease proteolytic subunit GB:PROTEIN_ID BAD56179.1 LENGTH 221 SQ:AASEQ MALIDPRAGLSGIAPSSPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDASANDIMAQLLVLESLDPDRDITMYINSPGGSFTSLMAIYDTMQYVRADVATVCLGQAASAAAVLLAAGTPGKRACLPNARVLIHQPSLEGGIQGQVSDLEIQAAEIERMRRLMETTLARHTGKDPDTIRKDTDRDKILTAEDAKEYGIIDTVFDYRKLSAQK GT:EXON 1|1-221:0| SW:ID CLPP3_NOCFA SW:DE RecName: Full=ATP-dependent Clp protease proteolytic subunit 3; EC=3.4.21.92;AltName: Full=Endopeptidase Clp 3; SW:GN Name=clpP3; OrderedLocusNames=NFA_13340; SW:KW ATP-binding; Complete proteome; Cytoplasm; Hydrolase;Nucleotide-binding; Protease; Serine protease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->221|CLPP3_NOCFA|e-117|100.0|221/221| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0008236|"GO:serine-type peptidase activity"|Serine protease| PROS 110->121|PS00381|CLP_PROTEASE_SER|PDOC00358| PROS 132->145|PS00382|CLP_PROTEASE_HIS|PDOC00358| COIL:NAA 29 COIL:NSEG 1 COIL:REGION 151->179| SEG 116->126|aasaaavllaa| BL:PDB:NREP 1 BL:PDB:REP 23->215|1yg6B|1e-49|47.1|191/192| RP:PDB:NREP 1 RP:PDB:REP 41->213|2cbyB|9e-50|44.1|161/170| RP:PFM:NREP 1 RP:PFM:REP 41->213|PF00574|1e-52|55.6|171/179|CLP_protease| HM:PFM:NREP 1 HM:PFM:REP 39->213|PF00574|2.4e-76|56.6|173/182|CLP_protease| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF00574|IPR001907| GO:PFM GO:0006508|"GO:proteolysis"|PF00574|IPR001907| RP:SCP:NREP 1 RP:SCP:REP 41->215|1tg6A1|5e-26|41.0|173/184|c.14.1.1| HM:SCP:REP 30->222|2f6iA1|1.3e-67|50.5|190/0|c.14.1.1|1/1|ClpP/crotonase| OP:NHOMO 1688 OP:NHOMOORG 1028 OP:PATTERN -------------------------------------------------------------------- 1112422222222222222-222222222222222244442445442222222222242233423225532222222211121111111111111111-11112211122222222222222222111111111112222211111344344433444444444432444444444444444411111112211222222222233222222211222111111122222233211111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111112111111112112111111211112111122111111111111111112111211111112211111111111111111112-1121111122213332332333331122111211111112222222222221121111111111111111111111111111111111111111211111111111112211111121211111111111111211121111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111221111111111--1111111111111111111111111111111111111111112111111111111111111111111111111111121211111111111111111111111111111222211111111111111111111111111111111111111211111111111111112222222222222222--------------------------1111111111121 22----122---1111111111111111111111111111111-1111111111111111111----------1---------------1211111111111-111-1D-21111211-1--111-1--151-1-111--11111-1-111---1--111111111-111512225866*78979JDKK19C6631117 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 89.1 SQ:SECSTR ######################ccccTccccccccccccEHHHHHHTTEEEEcccccHHHHHHHHHHHHHHHHHcTTccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEETHHHHHHHTccTTcEEEcTTcEEEccccGGcccTTccccccHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHTTcEEEHHHHHHHTcccEEccccccHH## DISOP:02AL 1-25, 216-221| PSIPRED cccccccccccccccccccccccccEEEEEcccccccccHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccccEEEccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHccccccccccccccccc //