[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : cobU
DDBJ      :cobU         putative cobinamide kinase/cobinamide phosphate guanylyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  362/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->176 1c9kB PDBj 5e-25 39.6 %
:RPS:PDB   6->176 1cbuC PDBj 5e-06 36.1 %
:RPS:SCOP  5->176 1c9kA  c.37.1.11 * 3e-42 38.4 %
:HMM:SCOP  4->176 1cbuA_ c.37.1.11 * 4e-40 43.3 %
:RPS:PFM   5->175 PF02283 * CobU 3e-24 48.8 %
:HMM:PFM   5->175 PF02283 * CobU 5.5e-54 49.1 165/167  
:BLT:SWISS 6->176 COBU_SALTY 1e-24 39.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56547.1 GT:GENE cobU GT:PRODUCT putative cobinamide kinase/cobinamide phosphate guanylyltransferase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1852978..1853508 GB:FROM 1852978 GB:TO 1853508 GB:DIRECTION + GB:GENE cobU GB:PRODUCT putative cobinamide kinase/cobinamide phosphate guanylyltransferase GB:PROTEIN_ID BAD56547.1 LENGTH 176 SQ:AASEQ MTRRTLVLGGARSGKSAFAERLAGESATVRYLATAVLDPADTDFADRVAGHRARRPAHWTTVDSADPATVLTAEPGFPGATLVDDLGTWLTARIDALDAWDAPRGTVAPAADALVAAVRDYPGRLVIVSPEVGMGVVPATRSGRLFRDEIGALNQALAAVCEEAYLVVAGLPLRLK GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 6->176|COBU_SALTY|1e-24|39.6|169/181| SEG 107->118|vapaadalvaav| BL:PDB:NREP 1 BL:PDB:REP 6->176|1c9kB|5e-25|39.6|169/180| RP:PDB:NREP 1 RP:PDB:REP 6->176|1cbuC|5e-06|36.1|169/179| RP:PFM:NREP 1 RP:PFM:REP 5->175|PF02283|3e-24|48.8|166/167|CobU| HM:PFM:NREP 1 HM:PFM:REP 5->175|PF02283|5.5e-54|49.1|165/167|CobU| GO:PFM:NREP 4 GO:PFM GO:0000166|"GO:nucleotide binding"|PF02283|IPR003203| GO:PFM GO:0043752|"GO:adenosylcobinamide kinase activity"|PF02283|IPR003203| GO:PFM GO:0043753|"GO:adenosylcobinamide-phosphate guanylyltransferase activity"|PF02283|IPR003203| GO:PFM GO:0051188|"GO:cofactor biosynthetic process"|PF02283|IPR003203| RP:SCP:NREP 1 RP:SCP:REP 5->176|1c9kA|3e-42|38.4|164/170|c.37.1.11| HM:SCP:REP 4->176|1cbuA_|4e-40|43.3|171/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 365 OP:NHOMOORG 362 OP:PATTERN -------------------------------------------------------------------- ----1-11111-1-11111-11--11111111111112111111----------------1-111111111-----------1-----11-1--11-----11--1-1-----------------1111-1111-1---11-----1111111111111111-1111111111-1---1111-11111-------------------------------------11111121--------------------------------------------------------------------------------1------------1-----------1------------1--1111111--11111------1-1--------1111----1111111111111111-1-1--1---1--1111111111111111-1-11-11111---------11-1111-------------------------------1--------11111--111111111111111-11111--1111211111111-111-11111----------111-111---1--1111-111111111-----1-1--------------------1----------1-1-11-11111--1----1111-11----11-------1---1--1111111111--11111111111111111-111---1-1111111111111111--111-11--1------------------------111-1-------------------------111111111-1---11111-------------1-----11111--11111111------1---1111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 100.0 SQ:SECSTR TTccEEEEEcTTccHHHHHHHHHccccEEEEEEccEEHHHHHHHHHHTTTccccccEEEEEEccccGGGTccccccTTcEEEEEcHHHHHHHHHHHHcTTccGHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEETTEEEEcc DISOP:02AL 176-177| PSIPRED cccEEEEEccccccHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHHcccccEEEEccccHHHHHHccccccEEEEEcHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEEcc //