[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : cysS
DDBJ      :cysS         putative cysteinyl-tRNA synthetase
Swiss-Prot:SYC1_NOCFA   RecName: Full=Cysteinyl-tRNA synthetase 1;         EC=6.1.1.16;AltName: Full=Cysteine--tRNA ligase 1;         Short=CysRS 1;

Homologs  Archaea  60/68 : Bacteria  906/915 : Eukaryota  189/199 : Viruses  1/175   --->[See Alignment]
a.27.1c.26.1
:467 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->397 1u0bB PDBj 4e-77 40.4 %
:RPS:PDB   3->376 3c8zA PDBj 2e-46 27.8 %
:RPS:PDB   415->450 2ahqA PDBj 2e-05 8.3 %
:RPS:SCOP  3->310 1li5A2  c.26.1.1 * 3e-38 41.0 %
:RPS:SCOP  314->460 1u0bB1  a.27.1.1 * 3e-27 31.0 %
:HMM:SCOP  2->312 1li5A2 c.26.1.1 * 2.6e-89 37.6 %
:HMM:SCOP  313->460 1u0bB1 a.27.1.1 * 1.3e-35 36.3 %
:RPS:PFM   16->311 PF01406 * tRNA-synt_1e 3e-87 51.4 %
:RPS:PFM   339->391 PF09190 * DALR_2 7e-05 41.5 %
:HMM:PFM   17->309 PF01406 * tRNA-synt_1e 6.1e-123 51.2 293/301  
:HMM:PFM   338->392 PF09190 * DALR_2 1.3e-14 41.8 55/63  
:BLT:SWISS 1->467 SYC1_NOCFA 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55280.1 GT:GENE cysS GT:PRODUCT putative cysteinyl-tRNA synthetase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 452353..453756 GB:FROM 452353 GB:TO 453756 GB:DIRECTION + GB:GENE cysS GB:PRODUCT putative cysteinyl-tRNA synthetase GB:PROTEIN_ID BAD55280.1 LENGTH 467 SQ:AASEQ MTLRLFDTESRTMREFAPLVPGRASVYLCGATVQGEPHIGHVRSGVAFDVLRRWLQAHDYDVWFIRNVTDIDDKILNKAAEAGRPWWEWAATYERAFDRAYRLLGVQPPSAEPRATGHITQMVELMRRLIERGHAYASAGNVYFDVQSYPEYGALSGHKLDDVHQGESAGEGKRDPRDFTLWKAAKPGEPSWPSPWGPGRPGWHLECSAMAEFYLGAEFDIHCGGMDLVFPHHENEIAQSKAAGDGFARYWLHNGWVTMGGEKMSKSLGNVLSVPNMLTKVRAVELRFYLGSAHYRSMLEYSDKALDDAVAGYQRIEAFLHRTAERVGEIPVGKWTDAFAEAMDDDLAVPRALAEVFRLVTEGNKALEAGAVDTARELGGQVRAMLGILGVCPFDPQWDHKQDDSVAQTALDVLVRAELDRRQQARADKDWATADAVRDRLHAAGIDVTDTPNGPEWSLRTARGKAN GT:EXON 1|1-467:0| SW:ID SYC1_NOCFA SW:DE RecName: Full=Cysteinyl-tRNA synthetase 1; EC=6.1.1.16;AltName: Full=Cysteine--tRNA ligase 1; Short=CysRS 1; SW:GN Name=cysS1; OrderedLocusNames=NFA_4380; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Metal-binding; Nucleotide-binding; Protein biosynthesis; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->467|SYC1_NOCFA|0.0|100.0|467/467| GO:SWS:NREP 7 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| SEG 187->203|pgepswpspwgpgrpgw| BL:PDB:NREP 1 BL:PDB:REP 3->397|1u0bB|4e-77|40.4|394/461| RP:PDB:NREP 2 RP:PDB:REP 3->376|3c8zA|2e-46|27.8|356/399| RP:PDB:REP 415->450|2ahqA|2e-05|8.3|36/67| RP:PFM:NREP 2 RP:PFM:REP 16->311|PF01406|3e-87|51.4|296/300|tRNA-synt_1e| RP:PFM:REP 339->391|PF09190|7e-05|41.5|53/65|DALR_2| HM:PFM:NREP 2 HM:PFM:REP 17->309|PF01406|6.1e-123|51.2|293/301|tRNA-synt_1e| HM:PFM:REP 338->392|PF09190|1.3e-14|41.8|55/63|DALR_2| GO:PFM:NREP 12 GO:PFM GO:0000166|"GO:nucleotide binding"|PF01406|IPR015803| GO:PFM GO:0004817|"GO:cysteine-tRNA ligase activity"|PF01406|IPR015803| GO:PFM GO:0005524|"GO:ATP binding"|PF01406|IPR015803| GO:PFM GO:0005737|"GO:cytoplasm"|PF01406|IPR015803| GO:PFM GO:0006412|"GO:translation"|PF01406|IPR015803| GO:PFM GO:0006423|"GO:cysteinyl-tRNA aminoacylation"|PF01406|IPR015803| GO:PFM GO:0000166|"GO:nucleotide binding"|PF09190|IPR015273| GO:PFM GO:0004817|"GO:cysteine-tRNA ligase activity"|PF09190|IPR015273| GO:PFM GO:0005524|"GO:ATP binding"|PF09190|IPR015273| GO:PFM GO:0005737|"GO:cytoplasm"|PF09190|IPR015273| GO:PFM GO:0006412|"GO:translation"|PF09190|IPR015273| GO:PFM GO:0006423|"GO:cysteinyl-tRNA aminoacylation"|PF09190|IPR015273| RP:SCP:NREP 2 RP:SCP:REP 3->310|1li5A2|3e-38|41.0|295/299|c.26.1.1| RP:SCP:REP 314->460|1u0bB1|3e-27|31.0|145/146|a.27.1.1| HM:SCP:REP 2->312|1li5A2|2.6e-89|37.6|311/315|c.26.1.1|1/1|Nucleotidylyl transferase| HM:SCP:REP 313->460|1u0bB1|1.3e-35|36.3|146/0|a.27.1.1|1/1|Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases| OP:NHOMO 1435 OP:NHOMOORG 1156 OP:PATTERN 1111111111111111111111111111111111---11111211--1--111-11111111111111 1112222222232322222-22222222222222222222322322222221222222222231233222211111111111111111111111111--1111111111111111111111111111111111111222221112222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111211111211111111111111111121111111111111111111123211111121111111111111111112231111111111111111111111111111111111111111111111111111111111-1111111111121111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111211111211111111111111111111111111111111111111111111-11111111111111111111111111111111 1111223-311111111111111111211111121111211111111111111111111111111111-21111121-1111111111-1211211111111111112324242422222-122562427K5-323-22231232-21--41142322224513232222212333222K2321243241322322222 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 452 STR:RPRED 96.8 SQ:SECSTR HHcEEEETTTTEEEEcccTTccEEEEEEccccTTccccHHHHHHHHHHHHHHHHHHHTTcEEEEEEEEccccHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHTTcccccEEEEGGGcHHHHHHHHHHHHHHTcEEEccccccccEEEcTTccTTTTTTTcccHHHHHHHHTcccTTcEEEEEEccTTccccccTTccEEEcHHHHHHHHHHHHTcccEEEEEEEGGGTTTHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHTTccHHHHHHHHHHHcHHHHHHHHHTccTTccccccHHHHHHHHHHHHHHHHHHTccccccHHHccHHHHHHHHHHHHcTccHHHHHHHHHHHHHHHHHHccccccHHHHHTTccHHHHHHHHHHHTTcHHHHHHTGGGccEEEEEEEHHHHTTcccccccccccccccccccccccccccccccc############### DISOP:02AL 162-173, 463-467| PSIPRED ccEEEEEccccEEEEEEcccccccEEEEEccEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccEEcccHHHHHHHHHHHHHcccEEEEcccEEEEcccccccHHHHcccHHHHHccccccccccccccEEEEcccccccccccccccccccccccHHHHHHHHHccccccEEEccHHHccccHHHHHHHHHHccccccEEEEEccEEEEcccccccccccEEcHHHHHHHccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEEEccccccc //