[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : dgt
DDBJ      :dgt          putative dGTPase
Swiss-Prot:DGTL1_NOCFA  RecName: Full=Deoxyguanosinetriphosphate triphosphohydrolase-like protein;

Homologs  Archaea  3/68 : Bacteria  580/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.211.1
:419 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->228 2dqbC PDBj 2e-36 50.9 %
:RPS:PDB   28->419 3bg2A PDBj 2e-32 26.8 %
:RPS:SCOP  34->220 2hekA1  a.211.1.1 * 3e-24 22.9 %
:HMM:SCOP  34->237 2hekA1 a.211.1.1 * 6.3e-52 48.5 %
:RPS:PFM   72->133 PF01966 * HD 1e-15 60.7 %
:HMM:PFM   71->215 PF01966 * HD 1.2e-21 34.8 112/118  
:BLT:SWISS 1->419 DGTL1_NOCFA 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56314.1 GT:GENE dgt GT:PRODUCT putative dGTPase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1649906..1651165 GB:FROM 1649906 GB:TO 1651165 GB:DIRECTION + GB:GENE dgt GB:PRODUCT putative dGTPase GB:PROTEIN_ID BAD56314.1 LENGTH 419 SQ:AASEQ MGDYTEHDRERMVVEGAKTAGLGSPDTEFTAGHRTQFARDRARVLHSAALRRLADKTQVMGPRDGDTPRTRLTHSIEVAQIGRSIADGLGCDPDLVDLAGLAHDIGHPPYGHNGEKALDAFADPYGGFEGNAQNLRILTRLEPKVLAPDGTSAGLNLTRAALDAAIKYPWGRTGPGTKFGAYDIDADRLAWIRKGAPDRVRSLECQIMDWSDDVAYSVHDVEDGVIAGRIDLRALADPQEQAALAAMGHRQHPELGVDELIAAAQRLSELPVVADAFRYDGTFASSVALKRLTSELVGRFATAAITATRAVAGPAPLVRYQASLGIPPIVAAEVAILKTVALRYVMSDPVHKQRQAAQRERIQAVATGLLATAPRHLDPQLLPWWVEADSDTARVRVIVDQIASYTESRLERVAAQLAG GT:EXON 1|1-419:0| SW:ID DGTL1_NOCFA SW:DE RecName: Full=Deoxyguanosinetriphosphate triphosphohydrolase-like protein; SW:GN OrderedLocusNames=NFA_14690; SW:KW Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->419|DGTL1_NOCFA|0.0|100.0|419/419| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| TM:NTM 1 TM:REGION 322->344| SEG 301->315|ataaitatravagpa| SEG 353->366|qrqaaqreriqava| BL:PDB:NREP 1 BL:PDB:REP 19->228|2dqbC|2e-36|50.9|175/360| RP:PDB:NREP 1 RP:PDB:REP 28->419|3bg2A|2e-32|26.8|332/397| RP:PFM:NREP 1 RP:PFM:REP 72->133|PF01966|1e-15|60.7|61/117|HD| HM:PFM:NREP 1 HM:PFM:REP 71->215|PF01966|1.2e-21|34.8|112/118|HD| RP:SCP:NREP 1 RP:SCP:REP 34->220|2hekA1|3e-24|22.9|179/369|a.211.1.1| HM:SCP:REP 34->237|2hekA1|6.3e-52|48.5|171/0|a.211.1.1|1/1|HD-domain/PDEase-like| OP:NHOMO 640 OP:NHOMOORG 583 OP:PATTERN -----------------------------1-------------1--1--------------------- 1211111111111111111-1111111111111111111111111111111111111111111122211111---11122211-11111111-111---111111-11-1--------------1-----------1111121111------------------1------------------11211111----------------------------------111111-1--------------------1----------------------------------1-------------------------21---111-111-111111111111-111111112-1-112121111111111111----11111111111111111111111111111111111-1111213112111111111111111111111131111211111111111111--1---1111111--11111111111111111111112111111111112111111111111111211211--1111111111111-111121111-------111111-2221---1-1----11211121112111-111-------------------22-11111111--122211211111111111121211--1-111------11121111111111111-1111211111111111111111111121111111121111111111-121-1-111111111111--1------1121-1112111111-1-11111111111111-11122221111111112111111112111111122122111111-------1--------11111111-----------------------------------------------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 399 STR:RPRED 95.2 SQ:SECSTR ##cccHHHHHHHTTc###ccccccccHGGccGGGcHHHHHHHHHHHcHHHHHGGGcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHTHHHHTHHHHTTTTccTTHHHHHHHHHHHHHTcGGccHHHHHHHHHHcccTccTTccTcTTTTcccHHHHHHHcccccccccccccccccGGGHHHHHHHHHHHTcccccTTHHHHHHHHHHHHHHHHHHHHHHHccccccccGGcccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHTcccHHHHHHHHHHHHHHHTcccHH###############cHHHHHccccTGGGcTTHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHTT DISOP:02AL 1-2, 15-34| PSIPRED cccccHHHHHHHccccHHHHHccccccccccccccHHHHHHHHccccHHHHHHHHccEEccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHccHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHcc //