[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : echA1
DDBJ      :echA1        putative enoyl-CoA hydratase/isomerase family protein
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  513/915 : Eukaryota  176/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->261 2vreA PDBj 1e-40 39.4 %
:RPS:PDB   9->271 1dciA PDBj 1e-40 35.1 %
:RPS:SCOP  9->270 1dciA  c.14.1.3 * 6e-48 35.6 %
:HMM:SCOP  1->273 1wdkA4 c.14.1.3 * 1.9e-74 39.5 %
:RPS:PFM   16->194 PF00378 * ECH 2e-21 37.5 %
:HMM:PFM   16->196 PF00378 * ECH 1.6e-38 37.6 170/170  
:BLT:SWISS 1->271 ECH1_DICDI 1e-49 41.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55225.1 GT:GENE echA1 GT:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 399203..400024 GB:FROM 399203 GB:TO 400024 GB:DIRECTION + GB:GENE echA1 GB:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GB:PROTEIN_ID BAD55225.1 LENGTH 273 SQ:AASEQ MTDWQAFTVEISDHVAQVTLTGPGKGNAMGPDFWRELPEIFAGLDADPQVRAVVITGSGKHFSYGLDLPAMSGTFGPLMADRALAAPRTDFLKEIRRLQASINSVAECSKPVIAAVSGWCIGGGVDLIAAADIRLASADAQFSVREAKVAIVADVGSLQRLPGIIGEGHLRELAYTGKDIDAARAEKIGLVNDVYPDQQAVLAAAHALAREIAANPPLVVQGVKDVLEQRRVNDIAEGLRYVSAWNAAFLPSEDLTEAIQAVFEKRAPEFKGR GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 1->271|ECH1_DICDI|1e-49|41.6|267/293| SEG 126->140|dliaaadirlasada| SEG 200->214|avlaaahalareiaa| BL:PDB:NREP 1 BL:PDB:REP 14->261|2vreA|1e-40|39.4|246/272| RP:PDB:NREP 1 RP:PDB:REP 9->271|1dciA|1e-40|35.1|262/275| RP:PFM:NREP 1 RP:PFM:REP 16->194|PF00378|2e-21|37.5|168/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 16->196|PF00378|1.6e-38|37.6|170/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 9->270|1dciA|6e-48|35.6|261/275|c.14.1.3| HM:SCP:REP 1->273|1wdkA4|1.9e-74|39.5|263/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 2979 OP:NHOMOORG 723 OP:PATTERN 22-1--3744644655-111211741121214-----------------------------1321-11 233171-2---212CHB55-5D22CH55555BFEHE7DYS-E2A---3-111222212--779-3799482--------12-5-----------111--2-111141311--------------1111112-111-23331---251111--111--------11--1111------------23212---2223333322424242223622224422655321------7--------------------1--1---------------------------------------------------------------------1231111111212-2221221-2-1-2-11-341415-15---1--1-1--955D-----2-LDH212BCFBB34443442443-1241292465H-722133665555245B33652445556--------211-1551------------------------------8CK7-3LJ9C6898F7544437756666536A7LCPNK1178474487D6A9FG123----33----------B773O77-----------5552A12--12213321---------------------------33-16-313422333333433333342343---1-1-------41121124334443444-34443334343443343343332123-454444444444444431233333--111111111111---------1111-3612----1--1111111188858275553155554537254564333-------------4-----353442231311333-------1443322------------------------------------------------1 ----431-532-4457543456585744544243323A67665525455555B644223222211----1--111------11111---57154432221225455-76357544342211352842325O4-555122254344124213115123366B446522437D75451232N2212464463355354343 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 273 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHTcTTccEEEEEEcTTcccccccHHHHHHHHTcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEETHHHHHHTTccEEEEETTcEEEccGGGGTccccccHHHHGGGTcccHHHHHHHHHccEEEHHHHHHHTcccEEEccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHTccHHHHHHHHHHHTTccGGGccH DISOP:02AL 270-273| PSIPRED ccccEEEEEEEEccEEEEEEcccHHcccccHHHHHHHHHHHHHHHcccccEEEEEEcccccEEccccHHHHHcccccccccHHccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccc //