[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : echA11
DDBJ      :echA11       putative enoyl-CoA hydratase/isomerase family protein
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  274/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->264 3hrxF PDBj 1e-26 38.2 %
:RPS:PDB   28->263 1dubA PDBj 3e-26 22.2 %
:RPS:SCOP  28->261 1uiyA  c.14.1.3 * 2e-28 25.4 %
:HMM:SCOP  1->264 1wdkA4 c.14.1.3 * 5.9e-71 39.9 %
:RPS:PFM   28->184 PF00378 * ECH 4e-10 33.1 %
:HMM:PFM   18->188 PF00378 * ECH 1.3e-43 37.5 168/170  
:BLT:SWISS 38->264 PAAG_ECOLI 2e-17 33.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57006.1 GT:GENE echA11 GT:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2331557..2332351 GB:FROM 2331557 GB:TO 2332351 GB:DIRECTION + GB:GENE echA11 GB:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GB:PROTEIN_ID BAD57006.1 LENGTH 264 SQ:AASEQ MTTGTSTVDLRVEAALATLTLRRAAASNALDLATKNDLLAAVTRIAADETVRAVLLTAEGKNFCVGQDLGEHVDALRADPATAMDTVGAHYNPLLRALADLPVPVVVAIRGACVGAGLGLALAADIRVAGNGAKFATAFTGIGLAADSGLSHTLVRALGASRAAGLMLLGDRFTAEQALAWGLIHRLVADDDVDATAAELATTLAHGPTAAYRQVKQLLRAESAGLADALERERVAQEALGASRDHRAAVEAFLTKTAPVFEGR GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 38->264|PAAG_ECOLI|2e-17|33.2|226/262| SEG 14->26|aalatltlrraaa| SEG 93->108|pllraladlpvpvvva| SEG 115->124|gaglglalaa| SEG 187->205|lvadddvdataaelattla| BL:PDB:NREP 1 BL:PDB:REP 28->264|3hrxF|1e-26|38.2|228/250| RP:PDB:NREP 1 RP:PDB:REP 28->263|1dubA|3e-26|22.2|230/260| RP:PFM:NREP 1 RP:PFM:REP 28->184|PF00378|4e-10|33.1|154/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 18->188|PF00378|1.3e-43|37.5|168/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 28->261|1uiyA|2e-28|25.4|232/253|c.14.1.3| HM:SCP:REP 1->264|1wdkA4|5.9e-71|39.9|263/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 594 OP:NHOMOORG 310 OP:PATTERN ------111111111---------2--1---3--------------------------------1--- ----31-1--111-242----4--12-----24232467C13-1---1----111121--134-1124341---------1-2----------------1-----3-1-----------------------------11-----2--------------------------------------1--12---2------------1---112--------22213-------2--------------------------------------------------11111111111111111111111111111111111111111--------------------111-1---2--------1---2--------2--4224-----1-9441--3173222222331331-11--12-3117-111---1--22112-31224-122142--------1----2--------------------------------2463-265281111611111122211111113186696--22221-11412355--1-----1----------4321412------------1--1---------121-----------------------------------211-------2------1---1--------------------1---1---11--111---1-1-----1--1222---------------------1-----------------------------------1--1---------------33313-3221-1333312---2231----------------------------------------------------------------------------------------------------- --------111---11--11111-----------------------1-------1-------1---------------------------2---11-------------------------------------------------1------------2------------11--1---------1--3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 99.6 SQ:SECSTR #ccccccEEEEEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHcTTccEEEEEccccEEEccccHHHHTTcHTcccHcHHHHHHTTTTTTTTGGGGccccEEEEEccEEETHHHHHHHHccEEEEETTcEEEcGGGGGTccccccTTTHHHHHHcHHHHHHHHHHcccEEHHHHHHHTcccEEEcTTTHHHHHHHHHHHHHHccHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHTTcHHHHHHHHHHHTTcccccccH DISOP:02AL 1-2, 261-264| PSIPRED ccccccEEEEEEEccEEEEEEccHHHcccccHHHHHHHHHHHHHHHcccccEEEEEEcccccEEccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccEEccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccc //