[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : echA13
DDBJ      :echA13       putative enoyl-CoA hydratase/isomerase family protein
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  639/915 : Eukaryota  167/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:260 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->257 3h81B PDBj 5e-37 36.8 %
:RPS:PDB   6->259 1dubB PDBj 2e-46 31.2 %
:RPS:SCOP  9->257 1uiyA  c.14.1.3 * 3e-51 35.9 %
:HMM:SCOP  1->257 2fw2A1 c.14.1.3 * 1.4e-80 46.6 %
:RPS:PFM   14->180 PF00378 * ECH 7e-23 43.1 %
:HMM:PFM   14->181 PF00378 * ECH 1.1e-50 44.6 168/170  
:BLT:SWISS 1->259 CAID_SALTI 9e-42 40.9 %
:PROS 98->118|PS00166|ENOYL_COA_HYDRATASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57789.1 GT:GENE echA13 GT:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3123037..3123819) GB:FROM 3123037 GB:TO 3123819 GB:DIRECTION - GB:GENE echA13 GB:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GB:PROTEIN_ID BAD57789.1 LENGTH 260 SQ:AASEQ MSDAATLERRGSVALITLNRPDAMNAVDSALSRAVGAALEQLAEDPQLRVGVITGAGRAFCAGADLKALAAGQNIGDPEHPEYGFAGLVQHFVDKPLIAAVNGFALGGGTEIVLACDLAVMSDQASLGLPEVKRGLVAAAGGLLRLPRQIPHKIALEMALTGAPVDAETAARWGLVNRVVPADQVLAVALELAETIAANAPLAVRASKRIIHRAAAFGSDWDAPIWQMNMEQTMPVFLSKDAAEGPRAFAEKRAPQWRGE GT:EXON 1|1-260:0| BL:SWS:NREP 1 BL:SWS:REP 1->259|CAID_SALTI|9e-42|40.9|257/261| PROS 98->118|PS00166|ENOYL_COA_HYDRATASE|PDOC00150| SEG 134->148|rglvaaaggllrlpr| BL:PDB:NREP 1 BL:PDB:REP 7->257|3h81B|5e-37|36.8|247/255| RP:PDB:NREP 1 RP:PDB:REP 6->259|1dubB|2e-46|31.2|250/259| RP:PFM:NREP 1 RP:PFM:REP 14->180|PF00378|7e-23|43.1|167/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 14->181|PF00378|1.1e-50|44.6|168/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 9->257|1uiyA|3e-51|35.9|245/253|c.14.1.3| HM:SCP:REP 1->257|2fw2A1|1.4e-80|46.6|253/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 5270 OP:NHOMOORG 840 OP:PATTERN 33-1--5987988976-121211952231237-----------------------------1331-11 2344D325113443LeSGG-GR66PdHGHHHMWUbUIPim1S3O112512227464441187I1ABJD6C6--------1418-----1111-1211--31222254323--------------11111121112156655---4811111111111111111111-112111111111111143333---7426666655757575554655337755BA96411111118-111111111111111111111-1----1-----11---1-111111---11111-------------1111111111111---111---1--1231111111212-2221221-211-3-11-561427-15---1--2-3--EBBJ-11-162TIL435OFOKG78887786888-21A12E3A8CR-9443669979BB787H77A9487776C--------433-1DC3-----------------------------1DJUC-3dSFO9DEENC7666599DE888747HBfPcjX24EE9985DCGBKFKT229----66----------G885UAB1---------17972F13--4534B632---------------------------671592949736666646955567587678---2-1-------42342346556665687-586865576756566666644422333454444444444444454545555--333333333333---1343333333-7645111-1--11111111DDCAD5968671BABB5B78587A88666----------1113-----464445545454544-------1554433-----------------------------------------------11 ----665-522-437AA749899B6AB9967467857B68887878676788EA8742443441---------1----------1--1-593A4531112537865-8B5KDA8A965332792D9374Dd7-B7A2355725C8-675-75283586EAD86H865849EB9983342W24345677F7966685557 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 260 STR:RPRED 100.0 SQ:SECSTR ccccEEEcGGGcEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHcTTccEEEEEccccEEEccccHHHHTTccHHHHHHTTTTTTGGGGGGcccccEEEEEccEEETHHHHHHHHccEEEEETTcEEEcGGGGGTccccccTTTHHHHHHcHHHHHHHHHHccEEEHHHHHHHTcccEEEcTTTHHHHHHHHHHHHHTccHHHHHHHHHHHHGGGTccHHcHHHHHHHHHHHHHHHTTcHHHHHHHHHHHTTcccccccc DISOP:02AL 256-260| PSIPRED cccEEEEEEEccEEEEEEccccccccccHHHHHHHHHHHHHHHcccccEEEEEEcccccEEccccHHHHcccccccHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccEEccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccc //