[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : echA14
DDBJ      :echA14       putative enoyl-CoA hydratase/isomerase family protein
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  663/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->303 3gowA PDBj 5e-35 37.2 %
:RPS:PDB   40->300 1dciA PDBj 2e-47 25.8 %
:RPS:SCOP  42->300 1uiyA  c.14.1.3 * 2e-54 35.3 %
:HMM:SCOP  39->303 1wdkA4 c.14.1.3 * 1.3e-83 46.2 %
:RPS:PFM   54->226 PF00378 * ECH 3e-25 44.6 %
:HMM:PFM   53->227 PF00378 * ECH 9.4e-49 41.7 168/170  
:BLT:SWISS 40->303 ECHA8_MYCTU 5e-34 35.4 %
:PROS 144->164|PS00166|ENOYL_COA_HYDRATASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57833.1 GT:GENE echA14 GT:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3170422..3171333) GB:FROM 3170422 GB:TO 3171333 GB:DIRECTION - GB:GENE echA14 GB:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GB:PROTEIN_ID BAD57833.1 LENGTH 303 SQ:AASEQ MGTRWSPDYVGWGRGRVILARLSDGVVPVHRIECGGPMSEPVLVERHGATVVWTLNSPRARNPISEPETIAALESAVAAAEADPDVRVAILTGAGAAFSSGGNIKHMRDKAGMFAGGPADLRPGYRHGIQRIPKALYDCEIPTIAAVNGPAIGAGCDLALMCDMRIAAHSAVFAESFVKVGLIPGDGGAWLLPRAVGMARASEMAFTGDAIDAATALEWGLVSRVVPDAELLPAAHALADRVAANPPHVLRMTKRLIREGQHQRLESLLELSAAMQAIAHTTGDHHEAVAAMLDKRPPRFTGR GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 40->303|ECHA8_MYCTU|5e-34|35.4|254/257| PROS 144->164|PS00166|ENOYL_COA_HYDRATASE|PDOC00150| SEG 71->89|aalesavaaaeadpdvrva| BL:PDB:NREP 1 BL:PDB:REP 42->303|3gowA|5e-35|37.2|250/254| RP:PDB:NREP 1 RP:PDB:REP 40->300|1dciA|2e-47|25.8|260/275| RP:PFM:NREP 1 RP:PFM:REP 54->226|PF00378|3e-25|44.6|166/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 53->227|PF00378|9.4e-49|41.7|168/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 42->300|1uiyA|2e-54|35.3|252/253|c.14.1.3| HM:SCP:REP 39->303|1wdkA4|1.3e-83|46.2|260/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 5482 OP:NHOMOORG 863 OP:PATTERN 22-1--5987988876-121211A73331338-----------------------------2331-11 2545C224--2342KcPGG-GN44QgHGHHHQWWcWHVns3U3T2124112154542411A9J1ADHD7B9--------1519-----1111-1211--31222253222--------------11111121111155545---48211211111111111111111222111111111111155523---7565555544646464443755456645B975411111119-111111111111111111111-1----1-----11---1-111111---11111111111111111111111111111111111111111--1351111111212-2221221-211-3-11-551427-15---1--2-4--FCCK-----41VHK324QISMF67756675777-22612F47ACS-8441767C9BCA8B8E77A9357789F--------622--BB4-----------------------------1CIVE-6iVHPCEGEOD77776DDIF999849KCYMckW23DEBB99CCHBIEKW229----65----------IBA4UAB1----1----17972E12--4544B743---------------------------551472A38636666645955566596579---2-1-------42642336556665688-586865576756555655645422333454444444444444454545555--333333333333---1121222222-6724222111111112111CCA8C4768651A99A5866586877556----------222622222463445544444444------11664444-----------------------------------------------11 ----655-533-545AA638778A6A98845454746B68887877577B88EA573333233---------1----------------583A5643321426655-AD5JHB7CCA74649A3KB4C5T*I-QCI6363C87A925A52A54C69BAIBHB7E87484589A874342U45444778E6678686656 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 303 STR:RPRED 100.0 SQ:SECSTR GGGTccccTTccccTHHHHHHHcccccEEEcTTccTccccEEEEEEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHTcTTccEEEEEEcTTcccccccHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEETHHHHHHTTccEEEEETTcEEEccGGGGTccccccHHHHGGGTccHHHHHHHHHHccEEEHHHHHHHTcccEEEccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHTccHHHHHHHHHHHTTccGGGccH DISOP:02AL 1-2, 300-303| PSIPRED ccccccHHHHcccccccccccccHHHccccccccccccccEEEEEEEccEEEEEEccHHHcccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccEEccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccc //