[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : echA4
DDBJ      :echA4        putative enoyl-CoA hydratase/isomerase family protein
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  338/915 : Eukaryota  116/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->220 2vx2I PDBj 3e-18 29.0 %
:RPS:PDB   11->224 2a7kB PDBj 1e-28 18.7 %
:RPS:SCOP  3->223 1dciA  c.14.1.3 * 9e-30 23.1 %
:HMM:SCOP  1->254 1wdkA4 c.14.1.3 * 1.4e-55 29.1 %
:RPS:PFM   15->177 PF00378 * ECH 8e-14 34.0 %
:HMM:PFM   14->178 PF00378 * ECH 6.7e-34 32.7 165/170  
:BLT:SWISS 45->220 ECHD3_MOUSE 1e-18 27.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55355.1 GT:GENE echA4 GT:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(525228..526001) GB:FROM 525228 GB:TO 526001 GB:DIRECTION - GB:GENE echA4 GB:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GB:PROTEIN_ID BAD55355.1 LENGTH 257 SQ:AASEQ MGINRHTESTGITVVTVDYPPVNAIPTDGWFAIADAVRAAGRDPETKVVVLRAENRGFNAGVDIKEIQSKPGHQALIDANHGCFEAFGAVYDCPVPVIAVVQGFCLGGGIGLVGNADVVIASDDATFGLPEVDRGALGAATHLARLVPQHLMRALFYTASTITAQQLHHHGSVYQVVPRAELDAAAMEVAKNIAAKDGRVIRAAKRALNGIDVQDVHRSYRYEQGFTFELNLAGVADEIRARFDDDLAARKAGNQEQ GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 45->220|ECHD3_MOUSE|1e-18|27.8|176/300| SEG 100->114|vvqgfclgggiglvg| BL:PDB:NREP 1 BL:PDB:REP 45->220|2vx2I|3e-18|29.0|176/254| RP:PDB:NREP 1 RP:PDB:REP 11->224|2a7kB|1e-28|18.7|214/230| RP:PFM:NREP 1 RP:PFM:REP 15->177|PF00378|8e-14|34.0|162/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 14->178|PF00378|6.7e-34|32.7|165/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 3->223|1dciA|9e-30|23.1|221/275|c.14.1.3| HM:SCP:REP 1->254|1wdkA4|1.4e-55|29.1|254/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 955 OP:NHOMOORG 476 OP:PATTERN 11----23445444-1-1-----52--1-111-------------------------------11-11 -2--31-1-----134333-34115B333335667632BA-516--11----2112----334-1135151---------1-3-----------21---1----11---1--------------------1---1-13332----2---------------------------------------------21-11111212221121122111-21211321--------2---------------------------------------------------------------------------------------------111111-1--111-1--111--2-1-1----111413--1---1--1----1333-------A442-2724331111111-11----1--312327-222---121122234612312355215--------2----322------------------------------295---8533-2333-2------31-----132448B7-121-1--22122144--1-----2----------121153------------1-2-4-1----1-3-1------------------------------1---1--21-----1-2----1-21-1--------------111111-1111111111-1111111111111111111222-----2212222222222222---11111--111111111111--------------11-1-------1-------33313-2111--22121321-424221-------------------------------------------1------------------------------------------------------- ----211-211---1-1--1-111-1111-------11111111-1----1-2121------1--------------------------23112221111111-12-2-14441133222212-21211281-213--1131131--21-2--21111122124-2-322-32231--1-----13112---1212112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 99.2 SQ:SECSTR ##EEEEcGGGTEEEEEEcccTTccccHHHHHHHHHHHHHHHHcTTccEEEEEccTTccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHTccccEEEEEccEEETHHHHHHTTccEEEEETTcEEEccGGGGTcccHHHHHHHHHcHHHHHHHHHHcccccHHHHHHHTcccEEEcHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHTTTccccccccHHH DISOP:02AL 250-257| PSIPRED cccEEEEEcccEEEEEEcccccccccHHHHHHHHHHHHHHHcccccEEEEEEcccccEEccccHHHHccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccHHHccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccc //