[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : echA7
DDBJ      :echA7        putative enoyl-CoA hydratase/isomerase family protein
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  284/915 : Eukaryota  55/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:270 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->268 3gowF PDBj 7e-20 35.0 %
:RPS:PDB   21->270 1dciA PDBj 4e-28 18.4 %
:RPS:SCOP  19->268 1uiyA  c.14.1.3 * 1e-31 23.3 %
:HMM:SCOP  20->268 2fw2A1 c.14.1.3 * 5.4e-68 36.7 %
:RPS:PFM   27->194 PF00378 * ECH 4e-07 28.7 %
:HMM:PFM   26->195 PF00378 * ECH 2.3e-38 29.6 169/170  
:HMM:PFM   163->237 PF09995 * DUF2236 0.00018 28.4 74/250  
:BLT:SWISS 24->268 PAAG_ECOLI 2e-16 33.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55568.1 GT:GENE echA7 GT:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(784286..785098) GB:FROM 784286 GB:TO 785098 GB:DIRECTION - GB:GENE echA7 GB:PRODUCT putative enoyl-CoA hydratase/isomerase family protein GB:PROTEIN_ID BAD55568.1 LENGTH 270 SQ:AASEQ MSTTESASAAPATAGFSAVQDGRILRVTITNPKRKNAIDYDTMVALGDTFLAAAQDRAVRAIVLTGAGGDFCTGADLSASAAESQRGITSDMVMDAANRLVRAIVDAPVPVIVSIKGAAAGVGVGIALAADLVYAAEDSYLLLAFINIGLMPDGGAAALVAAAAGRPLASRMALLGERLPATEAARAGLFTAVLPATELDAAVEAAAQKIATGPRRALELTKRALNQATLAALDETLATEKAGQTELLQSPDFAEGATAMLTKRKPVFAD GT:EXON 1|1-270:0| BL:SWS:NREP 1 BL:SWS:REP 24->268|PAAG_ECOLI|2e-16|33.2|244/262| TM:NTM 1 TM:REGION 106->128| SEG 2->18|sttesasaapatagfsa| SEG 111->130|vivsikgaaagvgvgialaa| SEG 154->165|ggaaalvaaaag| SEG 196->207|ateldaaveaaa| SEG 228->242|atlaaldetlateka| BL:PDB:NREP 1 BL:PDB:REP 20->268|3gowF|7e-20|35.0|243/252| RP:PDB:NREP 1 RP:PDB:REP 21->270|1dciA|4e-28|18.4|250/275| RP:PFM:NREP 1 RP:PFM:REP 27->194|PF00378|4e-07|28.7|167/170|ECH| HM:PFM:NREP 2 HM:PFM:REP 26->195|PF00378|2.3e-38|29.6|169/170|ECH| HM:PFM:REP 163->237|PF09995|0.00018|28.4|74/250|DUF2236| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 19->268|1uiyA|1e-31|23.3|249/253|c.14.1.3| HM:SCP:REP 20->268|2fw2A1|5.4e-68|36.7|248/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 914 OP:NHOMOORG 361 OP:PATTERN ---1--11111111-1-11-11131--1-1-3------------------------------1-1--- 11--31-1--11--5A444-46--684444445686586B-812---1----1--212--123--224-31---------1-2----------------2-----2-11---------------------1-----1221-----3-------------------------------------1--11---1----------1------12------1-32111-------5-----------------------------------------------------------------------------------------------------------------------2----23--2---2--------3--4446-------C6521-638231122112-221-------14228--11---1---22222413341222354--------3----411------------------------------258--3C8493445842333322333333334497BIC--45321265925775111----------------3331723------------1115-1---11-2211------------------------------1-1--21111111--311112141112--------------------1---1---11--111---1-1-----1--1212-----1-111111111111111-----------------------------------1--1---------------44424-2112-1111112--1111211---------------1----------------------------1111--------------------------------------------------- ------1--11---11----------------------------------1-3------------------------------------------------------2---3--231111212-212126B3-222-1-131133--22-21-21111422----1--2--11111----------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 93.3 SQ:SECSTR ##################EGETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHTcTTccEEEEEEcTTcccccccHHHHHHHHTccccccHHHHHHHHHHHHHHHccccEEEEEccEEETHHHHHHTTccEEEEETTcEEEccGGGGTccccccHHHHGGGTcccHHHHHHHHHccEEEHHHHHHHTcccEEEcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHTccHHHHHHHHHHHTTccGGGcc DISOP:02AL 1-15, 267-270| PSIPRED ccccccccccccccEEEEEEEccEEEEEEccHHHcccccHHHHHHHHHHHHHHHcccccEEEEEEcccccEEccccHHHHcccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccc //