[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : eutB
DDBJ      :eutB         putative ethanolamine ammonia-lyase large subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  216/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:468 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->442 2qezF PDBj 6e-83 51.9 %
:RPS:PFM   12->452 PF06751 * EutB e-163 66.7 %
:HMM:PFM   11->460 PF06751 * EutB 1.2e-223 67.0 442/444  
:BLT:SWISS 1->445 EUTB_ECOLI 3e-99 45.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57034.1 GT:GENE eutB GT:PRODUCT putative ethanolamine ammonia-lyase large subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2358395..2359801 GB:FROM 2358395 GB:TO 2359801 GB:DIRECTION + GB:GENE eutB GB:PRODUCT putative ethanolamine ammonia-lyase large subunit GB:PROTEIN_ID BAD57034.1 LENGTH 468 SQ:AASEQ MTYHQSVSGRNYSFGSLVEVLAKATPLRSGDQLAGCAAESDAERAAACWVLADLPLTTFLDEQVVPYETDAVTRLIVDGHDRAAFAPIAHLTVGGFRDWLLATAAGPDAAATLSGVAAGLTPEMVAAVSKLMRNQDLIAVAKAATVTSAFRTTIGLPGRIATRLQPNHPTDDPRGIAAATLDGLLMGCGDAVIGINPATDSPRATADLLHLLDDIRTRFDIPMQSCVLSHVTTTMALIERNVPVDLVFQSIAGTEGANASFGITLPMLAEANEAARSLGRGTVGDNVMYLETGQGSALSAGAHLGTGGLPVDQQTLEARAYAVARALDPLLVNTVVGFIGPEYLYDGKQIIRAGLEDHFCGKLLGLPMGVDVCYTNHAEADQDDMDTLLTLLGVAGAAFVIAVPGADDVMLGYQSLSFHDALYVRQVLGLRAAPEFETWLHGLGMADEAGRIRPVDAAASPLLALTTR GT:EXON 1|1-468:0| BL:SWS:NREP 1 BL:SWS:REP 1->445|EUTB_ECOLI|3e-99|45.2|436/453| SEG 34->48|agcaaesdaeraaac| SEG 100->113|llataagpdaaatl| SEG 381->392|dqddmdtlltll| BL:PDB:NREP 1 BL:PDB:REP 8->442|2qezF|6e-83|51.9|405/428| RP:PFM:NREP 1 RP:PFM:REP 12->452|PF06751|e-163|66.7|433/442|EutB| HM:PFM:NREP 1 HM:PFM:REP 11->460|PF06751|1.2e-223|67.0|442/444|EutB| GO:PFM:NREP 2 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF06751|IPR010628| GO:PFM GO:0008851|"GO:ethanolamine ammonia-lyase activity"|PF06751|IPR010628| OP:NHOMO 228 OP:NHOMOORG 218 OP:PATTERN -------------------------------------------------------------------- --1---------1-2---------11------1---1111-1--------------------1--1-1-------------------------------------11-------------------------------------1----------------------------------------------------------------------------1---1111112---------------------1-----------------------------------------------------------1----------111------------1---11-11---1----11-1-----------11---1--------11112---11111------------11111211----1--1--11----11----1--------11111111-11-1--1----------------------------------------1111111111111111111111111111--111111---1-11-------11------------1---1---1------1--------21----1-------------------------------11-2---1-1-----1--------------------------1------1111111111-11111111-1111111111222--11-1111111111111111111------------------------------------1---------------111111----1-11111211111111111--------------------------11111-----------11----------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 413 STR:RPRED 88.2 SQ:SECSTR #######ccccEEcccHHHHHHHHccccHHHHHTTcccccHHHHHHHHHHHHcc#HHHHHccccccTTTcHHHHHHHTTccHHHHHHHTTccHHHHHHHHHcTTccHHHHHH###HHHTccHHHHHHHHHTc#HHHHHHHHHTccccEEcccEEccTTccccEEccccccccHHHHHHH#HHHHHHTccccEEEEccccccHHHHHHHHHHHHHHHHHHTccccEEEcccHHHHHH##HTTcccccEEEEccccHHHHHHHTccHHHHHHHHHHHHHHcccc#cccc#EEEccccc######ccc###ccccHHH#HHHHHHHHHTTcccEEEEEEEEccccccccHHHHHHHHHHHHH#HHHHTc#cEEEEEEEcccGGGGHHHHHHHHHHHHTTcccEEEEEEcccHTHHHHcccHHHHHHHHHHHTccccHHHHHHHHT########################## DISOP:02AL 468-469| PSIPRED ccEEEEEccEEEEcccHHHHHHHccccccccEEHHHHcccHHHHHHHHHHHHHccHHHHHHccccccccccEEEEEEEcccHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccccEEEEEEccccccccHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHccccHHHHHHHHHHHHHHccccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHHccccEEHHHHHHccccHHcccHHHHHHHHHHHHHHHHHcccccccccccccHHccHHHHHHHHHHHHHHcccEEEEccccccEEEcccccHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccHHHHHccc //