[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : eutC
DDBJ      :eutC         putative ethanolamine ammonia-lyase small subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  214/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:258 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->211 PF05985 * EutC 2e-35 49.8 %
:HMM:PFM   10->242 PF05985 * EutC 3.1e-80 54.6 229/238  
:BLT:SWISS 12->258 EUTC_RHOER 2e-75 61.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57035.1 GT:GENE eutC GT:PRODUCT putative ethanolamine ammonia-lyase small subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2359817..2360593 GB:FROM 2359817 GB:TO 2360593 GB:DIRECTION + GB:GENE eutC GB:PRODUCT putative ethanolamine ammonia-lyase small subunit GB:PROTEIN_ID BAD57035.1 LENGTH 258 SQ:AASEQ MEIDNAADSPQDVWAPLRRTTQARIGLGRTGNALPTRRVLEFRAAHAAARDAVHLPFDAADFAERIAAVGLGAPSVVRSNAGDRGEYLRRPDLGRTPADLSAVPRTDADIGIVLADGLSPRALDEHGPGLLEALAAELRPHYRLAPPVLAVQARVALGDHIGAALGVGTLIVLIGERPGLSVADSLGIYLTHLPRPGRTDADRNCVSNIHPPEGLGYQRAAAITAALVAGARRLGRSGVALKDTSGDELAGTESLVLD GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 12->258|EUTC_RHOER|2e-75|61.1|247/257| SEG 43->52|raahaaarda| SEG 130->138|llealaael| SEG 219->241|raaaitaalvagarrlgrsgval| RP:PFM:NREP 1 RP:PFM:REP 8->211|PF05985|2e-35|49.8|201/237|EutC| HM:PFM:NREP 1 HM:PFM:REP 10->242|PF05985|3.1e-80|54.6|229/238|EutC| GO:PFM:NREP 2 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF05985|IPR009246| GO:PFM GO:0008851|"GO:ethanolamine ammonia-lyase activity"|PF05985|IPR009246| OP:NHOMO 222 OP:NHOMOORG 214 OP:PATTERN -------------------------------------------------------------------- --1---------1-2---------11-----11---1111-1--------------------1--1-1-------------------------------------11-------------------------------------1----------------------------------------------------------------------------1---1111112---------------------1-----------------------------------------------------------1----------1-1------------1---11-11--------11-1-----------11---1--------11112---11111------------11111211----1--1---1----11----1--------11111111-11-1--1----------------------------------------1111111111111111111111111111--111111---1-11-------11------------1---1---1------1----------------------------------------------11-2---1-1-----1--------------------------1------1111111111-11111-1111111111111222--11-111111111111111-1111---1-------------------------------1---------------11111-----1-11111111111111111--------------------------11111111--------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccccccccHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHcccHHHHcccccccccHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHcccEEEEEEEccccccccccEEEEEEEcccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccccccHHcccccEEEEc //