[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : fadB2
DDBJ      :fadB2        putative 3-hydroxyacyl-CoA dehydrogenase
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  513/915 : Eukaryota  157/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:347 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   96->290 3hdhA PDBj 2e-26 34.9 %
:RPS:PDB   95->291 1e9yA PDBj 6e-21 11.9 %
:RPS:SCOP  96->188 2b0jA2  c.2.1.6 * 5e-08 8.6 %
:RPS:SCOP  192->290 1wdkA2  a.100.1.3 * 8e-21 27.5 %
:HMM:SCOP  1->193 1f0yA2 c.2.1.6 * 1.1e-38 42.7 %
:HMM:SCOP  194->293 1f0yA1 a.100.1.3 * 8.9e-24 41.2 %
:RPS:PFM   96->188 PF02737 * 3HCDH_N 1e-16 44.1 %
:RPS:PFM   194->290 PF00725 * 3HCDH 1e-12 44.7 %
:HMM:PFM   5->190 PF02737 * 3HCDH_N 2.5e-48 43.5 177/180  
:HMM:PFM   194->291 PF00725 * 3HCDH 8.6e-21 42.1 95/97  
:BLT:SWISS 96->297 FADJ_SHEB8 4e-29 37.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56891.1 GT:GENE fadB2 GT:PRODUCT putative 3-hydroxyacyl-CoA dehydrogenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2225072..2226115) GB:FROM 2225072 GB:TO 2226115 GB:DIRECTION - GB:GENE fadB2 GB:PRODUCT putative 3-hydroxyacyl-CoA dehydrogenase GB:PROTEIN_ID BAD56891.1 LENGTH 347 SQ:AASEQ MTGVVAVVGAGRMGQGIAAALGFGKVEVIVVDLRDRGDAGEAYRAAARAEIRSSLARKVRLGLLADADLPEVLDRIRVVSRDAAADAMAQARLVFEAVPEVLAVKRAALSWIESVVGPDTPIASTTSSFLVSRLAEFVARPDRLLNAHWLNPADLMPLVEVSPSAATTPEVVEATCELLSAVGKTPVVCAASPGYIVPRLQALVMNEAVRMVEEGVADAAEIDRAVRIGFGSRFAVLGLLEFIDWGGCDTLFHASTYLRDELGERFAPAPLVERSMADSRPGTADGGGFYDIAPAARDDYRTRRIADFAQVLDATGQLHRYDDLPRRNGRAVAEVLSARPAGGSQDR GT:EXON 1|1-347:0| BL:SWS:NREP 1 BL:SWS:REP 96->297|FADJ_SHEB8|4e-29|37.8|196/706| SEG 3->11|gvvavvgag| SEG 34->57|rdrgdageayraaaraeirsslar| SEG 74->94|drirvvsrdaaadamaqarlv| BL:PDB:NREP 1 BL:PDB:REP 96->290|3hdhA|2e-26|34.9|192/291| RP:PDB:NREP 1 RP:PDB:REP 95->291|1e9yA|6e-21|11.9|185/238| RP:PFM:NREP 2 RP:PFM:REP 96->188|PF02737|1e-16|44.1|93/180|3HCDH_N| RP:PFM:REP 194->290|PF00725|1e-12|44.7|94/97|3HCDH| HM:PFM:NREP 2 HM:PFM:REP 5->190|PF02737|2.5e-48|43.5|177/180|3HCDH_N| HM:PFM:REP 194->291|PF00725|8.6e-21|42.1|95/97|3HCDH| GO:PFM:NREP 4 GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF02737|IPR006176| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02737|IPR006176| GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF00725|IPR006108| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00725|IPR006108| RP:SCP:NREP 2 RP:SCP:REP 96->188|2b0jA2|5e-08|8.6|93/242|c.2.1.6| RP:SCP:REP 192->290|1wdkA2|8e-21|27.5|91/95|a.100.1.3| HM:SCP:REP 1->193|1f0yA2|1.1e-38|42.7|185/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 194->293|1f0yA1|8.9e-24|41.2|97/99|a.100.1.3|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1996 OP:NHOMOORG 703 OP:PATTERN 11-1--4655555544-111121A52231-24-----------------------------2321-11 14139--4--122263333-3222373333332323569A245522231311323434--447-6578A82-----1111--3---------1-11---2-231142432------------------------1----11---2----1-------------------1-------------21222---221111111122112111131131111234221-------431--------------111-1-------1-----11---1-------111----------------------------------------2-1112111111111211222111-1-313-11-441317-14---1--1-4-16332-----335442221221234443343445-11711825653-322133422244472222294444448--------3---1341------------------------------1272-39847776777345558855555546A5D48551344344444544576--2----12----------7432732-1---------34314-11-22224312---------------------------22-321224322222222222223222222---21--------3222-223223333243-233322242322222322344422322222222222222222251222222--222222222222---2111112222-2422111--------1---55535323324-66654653454573112----------222222222222221111111111------11--------------1---------------------------------------- ----113-63--222242142234433111111111122222211111113343112223331--------------------------1-141113222222222-544A764454-322232321427R3-434-12-31233132--32131422546728532526-5A622211H1112244642332232224 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 62.8 SQ:SECSTR ##############################################################################################HHHHHHTcccHHHHHHHGGGcccTTTccTTHHHHccEEEEEEEETTEEEEEEEEcccccccccTTccccccccTTTTccccEEEEEEcccccEEEETTccGGccTTEEccGGGGTTEEEcccTTcEHHHHHHHEEEcTHHTTcTcEEEEEEEEccTTcEEccTTccccEEccHHHHHHHHHHHHTcTTcccccccccHHHHHHHHTGGGccccHHHHH################################### DISOP:02AL 61-66, 343-347| PSIPRED cccEEEEEEccHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHccccccEEEEccccccccccEEEEEccccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccccEEccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccc //