[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : fadB3
DDBJ      :fadB3        putative 3-hydroxyacyl-CoA dehydrogenase
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  560/915 : Eukaryota  163/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:293 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->284 3hdhA PDBj 4e-46 39.7 %
:RPS:PDB   9->93 3cmmC PDBj 2e-06 14.1 %
:RPS:PDB   70->285 1e9yA PDBj 1e-30 13.5 %
:RPS:SCOP  5->188 1f0yA2  c.2.1.6 * 9e-14 36.4 %
:RPS:SCOP  189->284 1f0yA1  a.100.1.3 * 8e-29 40.6 %
:HMM:SCOP  4->188 1wdkA3 c.2.1.6 * 2.9e-46 45.7 %
:HMM:SCOP  189->285 3hdhA1 a.100.1.3 * 2.4e-30 59.8 %
:RPS:PFM   9->187 PF02737 * 3HCDH_N 1e-26 46.6 %
:RPS:PFM   189->282 PF00725 * 3HCDH 5e-21 59.6 %
:HMM:PFM   9->186 PF02737 * 3HCDH_N 3.6e-54 47.5 177/180  
:HMM:PFM   189->284 PF00725 * 3HCDH 1.4e-30 55.2 96/97  
:BLT:SWISS 8->289 HBD_BACSU 6e-52 41.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57005.1 GT:GENE fadB3 GT:PRODUCT putative 3-hydroxyacyl-CoA dehydrogenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2330679..2331560 GB:FROM 2330679 GB:TO 2331560 GB:DIRECTION + GB:GENE fadB3 GB:PRODUCT putative 3-hydroxyacyl-CoA dehydrogenase GB:PROTEIN_ID BAD57005.1 LENGTH 293 SQ:AASEQ MTEPTVPQRVAVIGGGRMGAGIAQVFATLGSTVVVAEAGDRAAALDRIATGLRRAAERGALDGRDPETVLAAVRTVAAPRELPADADLVVEAVPENPALKAEVLAAADSVVGLGAVIASNTSSLSITELGAALDNPQRFLGMHFFNPVPASALVEIVLAPATDPAVVARVRGWVAALGKAEVLVNDSPGFATSRLGVCLGLEAIRMVEEGVADPAAIDRAMELGYRHPMGPLRSTDLVGLDVRLAIAEHLAATLGPRFTPPRLLREKVERGELGRKTGQGFYTWDTTASGGRA GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 8->289|HBD_BACSU|6e-52|41.3|281/287| SEG 165->176|avvarvrgwvaa| BL:PDB:NREP 1 BL:PDB:REP 8->284|3hdhA|4e-46|39.7|277/291| RP:PDB:NREP 2 RP:PDB:REP 9->93|3cmmC|2e-06|14.1|85/1006| RP:PDB:REP 70->285|1e9yA|1e-30|13.5|207/238| RP:PFM:NREP 2 RP:PFM:REP 9->187|PF02737|1e-26|46.6|178/180|3HCDH_N| RP:PFM:REP 189->282|PF00725|5e-21|59.6|94/97|3HCDH| HM:PFM:NREP 2 HM:PFM:REP 9->186|PF02737|3.6e-54|47.5|177/180|3HCDH_N| HM:PFM:REP 189->284|PF00725|1.4e-30|55.2|96/97|3HCDH| GO:PFM:NREP 4 GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF02737|IPR006176| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02737|IPR006176| GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF00725|IPR006108| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00725|IPR006108| RP:SCP:NREP 2 RP:SCP:REP 5->188|1f0yA2|9e-14|36.4|184/192|c.2.1.6| RP:SCP:REP 189->284|1f0yA1|8e-29|40.6|96/99|a.100.1.3| HM:SCP:REP 4->188|1wdkA3|2.9e-46|45.7|184/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 189->285|3hdhA1|2.4e-30|59.8|97/99|a.100.1.3|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 2277 OP:NHOMOORG 759 OP:PATTERN 11-1--4555655543-111121A5223112411---------------------------2331-11 24339--4--123263323-322237333333332356AA245522221311323434--447-7569A82-----1111-14---------1-11---3-232242332------------------------1-11111---311--1-------------------1-------------33322---3222222222332232222422322223443321------53111111111111111211-2--1----1-----11---1-------1111---------------------------------------2-1112111111111211222111-1-114112-651417-14---1--1-4-16332-----336553223333434443343444-22722824763-322223322233572223384343348--------4---1342------------------1--1--1----12282-4A948887778556667766666657A6E59672355455555655676113----23-------1119542845-----------44414-21-33335412---------------------------22-321224322222222222223222223---22--------3222-223223333243-233322242322222322344422322222222222222222251222222--222222222222---2111113333-2422111--------1---55535333326-66654653454574112111111111-222222222222222222222223------11111111--------1---------------------------------------- ----115-631-222143233333535111111111122222211111234544112223231--------------------------12141113222222222-574A7644453332344322549Q4-5553232333531432-43253453658929533535-7B622211H1112245842333353324 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 100.0 SQ:SECSTR ccccccccEEEEEcccHHHHHHHHHHHHTTccEEEEcccHHHHHHHHHHHHHHHHHHTTcccccccHHHHHTcccccHHHHHHHHHHHHHHHHHHTcccHHHHHHHGGGcccTTTccTTHHHHccEEEEEEEETTEEEEEEEEcccccccccTTccccccccTTTTccccEEEEEEcccccEEEETTccGGccTTEEccGGGGTTEEEcccTTcEHHHHHHHTTEEEcTTcEEEEEEEEccTTcEEccTTccccEcHHHHHHHHHHHHHHTcTTcccccccccccHHHHHHHH DISOP:02AL 1-3, 289-293| PSIPRED ccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHcccccEEEEEccccccccccEEEEEccccccHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccEEEEccccccccc //