[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : fadE22
DDBJ      :fadE22       putative acyl-CoA dehydrogenase
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  436/915 : Eukaryota  163/199 : Viruses  0/175   --->[See Alignment]
a.29.3e.6.1
:408 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   68->298 2vigE PDBj 5e-23 33.9 %
:RPS:PDB   13->404 1egcA PDBj 7e-47 23.6 %
:RPS:SCOP  53->252 1rx0A2  e.6.1.1 * 1e-36 26.3 %
:RPS:SCOP  255->400 1bucA1  a.29.3.1 * 6e-12 24.8 %
:HMM:SCOP  38->268 1w07A3 e.6.1.2 * 1.8e-59 35.9 %
:HMM:SCOP  255->405 1egdA1 a.29.3.1 * 6.7e-19 36.3 %
:RPS:PFM   255->400 PF00441 * Acyl-CoA_dh_1 9e-07 38.8 %
:HMM:PFM   148->200 PF02770 * Acyl-CoA_dh_M 2.8e-18 40.4 52/52  
:HMM:PFM   255->400 PF00441 * Acyl-CoA_dh_1 3.2e-18 38.3 141/150  
:HMM:PFM   18->142 PF02771 * Acyl-CoA_dh_N 6e-17 24.0 104/113  
:BLT:SWISS 68->298 ACADS_PONAB 1e-23 34.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57117.1 GT:GENE fadE22 GT:PRODUCT putative acyl-CoA dehydrogenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2448544..2449770) GB:FROM 2448544 GB:TO 2449770 GB:DIRECTION - GB:GENE fadE22 GB:PRODUCT putative acyl-CoA dehydrogenase GB:PROTEIN_ID BAD57117.1 LENGTH 408 SQ:AASEQ MRGDRPVQTRTLPDLGQFTEQARAWLAGMAPPRTAAAWGEGSDSVAVFENWTAEQERAHTDEIRAYEQAKFDAGWGALDWPADYGGRGLPMSYVLAFRRVEEEFAVPRRTEMFSVTQQLVAPTVAQWGTETQRERWVRAMLRTDLIACQLFSETEAGSDLASVRTRAVRTEDGGWRLDGHKVWTSGARVADLGVAVCRTDPAAPKHAGLTVFLVPMDTPGVTVRPIRQMTGGSSFNEVYLDDVRLPDEYRLGPVGKGWPVALTVLAAERLDGAHLGLANADRAVALAGHFGRALTDLERDRVADLVTRSYVQRVAAMRVAAAVVAGKDPGPEASIGKLLATDTMARTSEVVRLLLGRDLGADSGRWGHFAWTEHVLGAPGYRIAGGTDEIQHNIIAERVLGLPKEPRL GT:EXON 1|1-408:0| BL:SWS:NREP 1 BL:SWS:REP 68->298|ACADS_PONAB|1e-23|34.4|227/412| SEG 311->325|vqrvaamrvaaavva| BL:PDB:NREP 1 BL:PDB:REP 68->298|2vigE|5e-23|33.9|227/380| RP:PDB:NREP 1 RP:PDB:REP 13->404|1egcA|7e-47|23.6|365/387| RP:PFM:NREP 1 RP:PFM:REP 255->400|PF00441|9e-07|38.8|134/150|Acyl-CoA_dh_1| HM:PFM:NREP 3 HM:PFM:REP 148->200|PF02770|2.8e-18|40.4|52/52|Acyl-CoA_dh_M| HM:PFM:REP 255->400|PF00441|3.2e-18|38.3|141/150|Acyl-CoA_dh_1| HM:PFM:REP 18->142|PF02771|6e-17|24.0|104/113|Acyl-CoA_dh_N| GO:PFM:NREP 2 GO:PFM GO:0016627|"GO:oxidoreductase activity, acting on the CH-CH group of donors"|PF00441|IPR006090| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00441|IPR006090| RP:SCP:NREP 2 RP:SCP:REP 53->252|1rx0A2|1e-36|26.3|194/231|e.6.1.1| RP:SCP:REP 255->400|1bucA1|6e-12|24.8|141/151|a.29.3.1| HM:SCP:REP 38->268|1w07A3|1.8e-59|35.9|231/0|e.6.1.2|1/1|Acyl-CoA dehydrogenase NM domain-like| HM:SCP:REP 255->405|1egdA1|6.7e-19|36.3|146/155|a.29.3.1|1/1|Acyl-CoA dehydrogenase C-terminal domain-like| OP:NHOMO 4963 OP:NHOMOORG 628 OP:PATTERN 33----4677977865-132421A96661-7A-----------------------------123---- 4446S1-2---622P*gKK-Kg11ggKKKKKUklylRi**3b8f1123----344444--GGQ1BCJJGKF--------242B-----------11---21333454443--------------------------56566---83-1-1------------------12-------------66666--18635555545555555553455545557898A11------42------------------------------------------------------------------------------------------1131244444442422211211--6-3-4-13-881465-17---11-3-51-MHHR-----1-MFF343KBJGE88787885755-22922B29A7S-355253533555886M88AA6665A8E111111117----885------------------------------IJOL17MEBN98ACI98477777FBAAAA5CJ5RQieZ-3BC7739CCJCEEKQ--7----34-------1-1F441OA7-----------755-6-5--7776A955---------------------------32-4A374B6-4222233733325482252---1---------1-3-------1-11-------------------------------2-1-11111-2-1--1-------------------------4111113343-CB-----------------CCBAC8945651FFFH7F9AEA79AA434-------------2-----24-223334344333-------1444444------------------------------------1--11-1------ ----448-731-556986564447369552545647776777757643333558554334443--------------------------69687764445566577-A64FCPAAC742427B5HA2E5M*B-EAM5614945E726534A51D8BB9J8ED5EBB45697DF8D1332A--13344575244385766 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 396 STR:RPRED 97.1 SQ:SECSTR ############HHHHHHHHHHHHHHHHHTTTTHHHHHHHccccHHHHHHHGHHHHHHHTcccHHHHHHHHHHTcccTTccTTTTcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHTccccEEEEcccTTccccGGGcccEEEEccccEEEEEEEEEEEETGGGccEEEEEccccTTccHHHHEEEEEEETTcTTEEEccccccccTccEEEEEEEEEEEEGGGccccTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccGGGcHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHGHHHTGGGGGcTTcHHHHHHHHHGGGGTTTccHHHHHHHHHHHHHHTTcHHHH DISOP:02AL 407-408| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHcHHHHccHHHHHEEEccccccccHHHcEEEEEEEcccEEEEEEEEEEEEccccccEEEEEEEEcccccccccEEEEEEEcccccEEEcccHHHcccccccEEEEccEEEcHHHccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccc //