[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : fadE4
DDBJ      :fadE4        putative acyl-CoA dehydrogenase
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  468/915 : Eukaryota  167/199 : Viruses  0/175   --->[See Alignment]
a.29.3e.6.1
:389 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   101->378 2pg0B PDBj 4e-31 37.9 %
:RPS:PDB   1->386 1egcA PDBj 9e-49 19.4 %
:RPS:SCOP  5->228 1rx0A2  e.6.1.1 * 9e-43 26.1 %
:RPS:SCOP  226->374 2c0uA1  a.29.3.1 * 2e-11 16.9 %
:HMM:SCOP  5->242 1w07A3 e.6.1.2 * 8.4e-69 37.4 %
:HMM:SCOP  229->384 1ukwA1 a.29.3.1 * 5.3e-16 25.5 %
:RPS:PFM   8->118 PF02771 * Acyl-CoA_dh_N 2e-08 34.9 %
:RPS:PFM   122->173 PF02770 * Acyl-CoA_dh_M 3e-06 47.1 %
:RPS:PFM   230->378 PF00441 * Acyl-CoA_dh_1 4e-05 30.5 %
:HMM:PFM   6->118 PF02771 * Acyl-CoA_dh_N 3.6e-26 35.5 110/113  
:HMM:PFM   229->380 PF00441 * Acyl-CoA_dh_1 8.2e-21 24.8 141/150  
:HMM:PFM   122->174 PF02770 * Acyl-CoA_dh_M 3.1e-20 40.4 52/52  
:BLT:SWISS 6->378 ACADL_RAT 2e-26 27.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55292.1 GT:GENE fadE4 GT:PRODUCT putative acyl-CoA dehydrogenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 467077..468246 GB:FROM 467077 GB:TO 468246 GB:DIRECTION + GB:GENE fadE4 GB:PRODUCT putative acyl-CoA dehydrogenase GB:PROTEIN_ID BAD55292.1 LENGTH 389 SQ:AASEQ MFIDLTAEQRALRDELRSYFAGLVTPEEEAEMAVNRHGDAYRAVVRRMGRDGWLGVGWPKEFGGQGFGPVEQQIFYNEAVRADVPLPLVTLLTVGPTLQVYGTEEQKQKFLPAILTGDIHFAIGYSEPEAGTDLAALRTSAVRDASGDWIVNGQKIFTTGAHEADYIWLACRTGTVESRHRGITILIVDTKDPGYSWTPIITCDGAHHTNATYFDNVRVPANMLVGEENRGWQLITTQLNHERVGLGPSGKIEQLYDRVREWAAAQGVLAEPDVRRTLGRVHAMVRLNELLNWQVAGTAERADADQSQVIADASATKVFSTEKLQEAGRLVEEIVGRYGDPAEPATAELLGWLDRRTKQNLVVTFGGGVNEIMRELVATAGLKLPRVPR GT:EXON 1|1-389:0| BL:SWS:NREP 1 BL:SWS:REP 6->378|ACADL_RAT|2e-26|27.4|361/430| SEG 84->98|vplplvtlltvgptl| BL:PDB:NREP 1 BL:PDB:REP 101->378|2pg0B|4e-31|37.9|256/377| RP:PDB:NREP 1 RP:PDB:REP 1->386|1egcA|9e-49|19.4|371/387| RP:PFM:NREP 3 RP:PFM:REP 8->118|PF02771|2e-08|34.9|106/113|Acyl-CoA_dh_N| RP:PFM:REP 122->173|PF02770|3e-06|47.1|51/53|Acyl-CoA_dh_M| RP:PFM:REP 230->378|PF00441|4e-05|30.5|141/150|Acyl-CoA_dh_1| HM:PFM:NREP 3 HM:PFM:REP 6->118|PF02771|3.6e-26|35.5|110/113|Acyl-CoA_dh_N| HM:PFM:REP 229->380|PF00441|8.2e-21|24.8|141/150|Acyl-CoA_dh_1| HM:PFM:REP 122->174|PF02770|3.1e-20|40.4|52/52|Acyl-CoA_dh_M| GO:PFM:NREP 6 GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02771|IPR006092| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02771|IPR006092| GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02770|IPR006091| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02770|IPR006091| GO:PFM GO:0016627|"GO:oxidoreductase activity, acting on the CH-CH group of donors"|PF00441|IPR006090| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00441|IPR006090| RP:SCP:NREP 2 RP:SCP:REP 5->228|1rx0A2|9e-43|26.1|218/231|e.6.1.1| RP:SCP:REP 226->374|2c0uA1|2e-11|16.9|142/170|a.29.3.1| HM:SCP:REP 5->242|1w07A3|8.4e-69|37.4|235/0|e.6.1.2|1/1|Acyl-CoA dehydrogenase NM domain-like| HM:SCP:REP 229->384|1ukwA1|5.3e-16|25.5|145/0|a.29.3.1|1/1|Acyl-CoA dehydrogenase C-terminal domain-like| OP:NHOMO 5431 OP:NHOMOORG 665 OP:PATTERN 22----5766766666-243432B96641-59-----------------------------4551--- 4445P1-1---623Q*fKK-Kh11elKKKKKTkiviTfx*3a8g-123----333334--FFR19BLGGLD--------1316---------1-22---41444454424--------------------------55577---73-1---------------------2-------------77656---9635555545555555553455545557998A-1------42----------------------1-------------------------------------------------------------------11315444444444423222221-6-3-4-13-871475-17---11-3-71-NJJS-----21SKM343ODNKI99898996867-44A44A4B99U-4553535546569D8OB9BA5655B7F111111118----896-----------------------------1KKRL17LEAJAACEMA7377799IDAAAA6BN9TTphb15CD9A5AEEKCCGIU228----46---------1F662VDB-----------765-9-5--66869856---------------------------22-3D475B7-3444445844444484455-------------1-4----1112122111-11111111-111111111---------212-2222212-2--2-111---------------------2111114344-EB13---------------FFECFAC7876-JJJK8GBDECACCD647-------------2-----24-224554544555-------2BB98AA----------1-------------------------1--11-1------ ----446-421-999BAA89889977BAA68686669989799AAA865568AB676556563------1--1--------1-------686A7764434885BA8-A33HCS9AB755424B7F92D4GrA-A8J47139448726443A3-98999L8DC5HAB36477BCAF2113O3322252479244387768 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 389 STR:RPRED 100.0 SQ:SECSTR ccccccHHHHHHHHHHHHHHHHHTTTTHHHcccHHHHccccHHHHHHHHHHTcccTTccTTTTcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHTccccEEEEcccTTccccGGGcccEEEEcTccEEEEEEEEEEEETGGGccEEEEEEEccccTTHHHHEEEEEEETTcTTEEEccccccccTccEEEEEEEEEEEEGGGccccTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcccccccGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGGGcTTcTHHHHHcHHHHHHHHHGGGGTTTccHHHHHHHHHHHHHHTTcHHH DISOP:02AL 386-389| PSIPRED ccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHcHHHHHHHHHHHHHcccccccccHHHcEEEEEEccccEEEEEEEEEEEEccccccEEEEEEEEcccccccccEEEEEEEcccccEEEcccHHHcccccccEEEEcccEEcHHHccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccc //