[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : fdhD
DDBJ      :fdhD         putative formate dehydrogenase accessory protein
Swiss-Prot:FDHD_NOCFA   RecName: Full=Protein fdhD homolog;

Homologs  Archaea  36/68 : Bacteria  488/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.97.1
:279 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->269 2pw9D PDBj 3e-18 32.0 %
:RPS:SCOP  14->269 2pw9A1  c.97.1.5 * 2e-55 29.1 %
:RPS:PFM   27->269 PF02634 * FdhD-NarQ 1e-52 55.2 %
:HMM:PFM   27->269 PF02634 * FdhD-NarQ 5.8e-83 51.5 231/236  
:BLT:SWISS 1->279 FDHD_NOCFA e-150 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56184.1 GT:GENE fdhD GT:PRODUCT putative formate dehydrogenase accessory protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1497264..1498103) GB:FROM 1497264 GB:TO 1498103 GB:DIRECTION - GB:GENE fdhD GB:PRODUCT putative formate dehydrogenase accessory protein GB:PROTEIN_ID BAD56184.1 LENGTH 279 SQ:AASEQ MSGRVTARRRVVRLTPAGEIRRQDTLAVEEPLEIRIGGQSLTVTMRTPGSDIDLVHGFLLSENMIGAAEDVVSARYCAGTDEQGRNTYNVLDVELRRPVPVRTRHVLTTGACGLCGKTALDEVRAVTRFPLPAHGVTLAADVLADLPATLRAGQSVFQATGGLHAAGLFTVDGTPLAVREDIGRHNAVDKVIGWALRENRVPAHELVLIVSGRASFELVQKAVMAGIPILGAVSAPSSLAVDLAEEAGLTLVGFLRGETMNVYSGAHRLRSVSAGTRTA GT:EXON 1|1-279:0| SW:ID FDHD_NOCFA SW:DE RecName: Full=Protein fdhD homolog; SW:GN Name=fdhD; OrderedLocusNames=NFA_13390; SW:KW Complete proteome; Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->279|FDHD_NOCFA|e-150|100.0|279/279| GO:SWS:NREP 1 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| SEG 4->13|rvtarrrvvr| BL:PDB:NREP 1 BL:PDB:REP 14->269|2pw9D|3e-18|32.0|225/237| RP:PFM:NREP 1 RP:PFM:REP 27->269|PF02634|1e-52|55.2|230/234|FdhD-NarQ| HM:PFM:NREP 1 HM:PFM:REP 27->269|PF02634|5.8e-83|51.5|231/236|FdhD-NarQ| GO:PFM:NREP 2 GO:PFM GO:0008863|"GO:formate dehydrogenase activity"|PF02634|IPR003786| GO:PFM GO:0009326|"GO:formate dehydrogenase complex"|PF02634|IPR003786| RP:SCP:NREP 1 RP:SCP:REP 14->269|2pw9A1|2e-55|29.1|220/231|c.97.1.5| OP:NHOMO 626 OP:NHOMOORG 527 OP:PATTERN ------11111111111------1--------1-1111111111212211111------1-111---- ---11111111---11111-11--121111111111112311-11-11----1211-1----1-1121111--------1211----------------------1-1----------------------------11111---------11-----------------11------------11-11---1-12222222212222221111112211111---1111111-1111111111111111--11-----------------------------------------------------------------------11-1-----------1----------13--11111111-111-------11-111------113111-1121111111111--11-1111111111--11111111112111--1111111111111111111111-12-------------------------------1-111-111-22221221111122111111112113333-12222211111112133--11111----------21--1111112111111-313-2121-1111113211---11111--1-------131--2233----3-1-111222-2232211221111-------------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111-------------1--21111111111111--111111-11111-11111121111112111----------111111111121111111111111------------------------------------------------------------11- -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 226 STR:RPRED 81.0 SQ:SECSTR #############EccccEEEEEEEEEccEEEEEEETTEEEEEEEEccccHHHHHHHHHHHTTccccGGGEEEEEEET####TTEEEEEEcccccccccc################HHHHccccccccccccH######HHHHHHHHHHHTcccHHHH#HcccEEEEEEE#TTEEEEEEEEccHHHHHHHHHHHHHTTcc##ccccEEEEcccccHHHHHHHHHTTccEEEEcccccHHHHHHHHHHTcEEEEEEETTEEEEEEcGGGc########## DISOP:02AL 1-6, 274-275, 277-279| PSIPRED ccccEEccEEEEEEEccEEEEEEEEEEEEEEEEEEEccEEEEEEEEccccHHHHHHHHHHHccccccHHHEEEEEEEccccccccEEEEEEEHHHHccHHHHHccEEcccccccccHHHHHHHHHcccccccccccEEcHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccEEEEEEEcccHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccEEEEEEEccccEEEccHHHEEEcccccccc //