[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : fruK
DDBJ      :fruK         putative fructose-1-phosphate kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  263/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.72.1
:316 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->192 2abqA PDBj 3e-11 33.1 %
:RPS:PDB   1->193 2awdA PDBj 8e-11 26.8 %
:RPS:SCOP  2->253 2ajrA1  c.72.1.1 * 2e-33 20.7 %
:HMM:SCOP  1->301 2f02A1 c.72.1.1 * 7.1e-52 34.1 %
:HMM:PFM   8->297 PF00294 * PfkB 5.1e-38 27.8 281/300  
:BLT:SWISS 1->192 LACC_STRA5 8e-16 33.0 %
:PROS 250->263|PS00584|PFKB_KINASES_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57702.1 GT:GENE fruK GT:PRODUCT putative fructose-1-phosphate kinase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(3039331..3040281) GB:FROM 3039331 GB:TO 3040281 GB:DIRECTION - GB:GENE fruK GB:PRODUCT putative fructose-1-phosphate kinase GB:PROTEIN_ID BAD57702.1 LENGTH 316 SQ:AASEQ MIVTLTANPSIDRTVTLAEPLHRGAVHRARGVAVHPGGKGVNVSRVVAAAGVPTVAVLPGNADDPLLRALTEAGIAHRSVPTSGSARINLTVTETDGTTTKINEPGQPLTGDALRDLAGLLAELAAQAAWVVLSGSLPPAVPTDWYVDLIRALPHARIAVDTSDAPLRAVADGIGAAAPDLVKPNSEELAQLTGLDPAALADPLAAARAAAGLVDRGIGAVLATLGAAGAVLATAEGAWHATAPAIRPRSTVGAGDAALAGYLLADLAGAAPADRLRRAVAYGSAAAALPGTGLPGPHHTDPDAVAVTALDLLPHS GT:EXON 1|1-316:0| BL:SWS:NREP 1 BL:SWS:REP 1->192|LACC_STRA5|8e-16|33.0|188/310| PROS 250->263|PS00584|PFKB_KINASES_2|PDOC00504| SEG 46->57|vvaaagvptvav| SEG 109->133|ltgdalrdlagllaelaaqaawvvl| SEG 194->213|gldpaaladplaaaraaagl| SEG 219->238|gavlatlgaagavlataega| SEG 254->300|agdaalagylladlagaapadrlrravaygsaaaalpgtglpgphht| BL:PDB:NREP 1 BL:PDB:REP 2->192|2abqA|3e-11|33.1|178/302| RP:PDB:NREP 1 RP:PDB:REP 1->193|2awdA|8e-11|26.8|190/310| HM:PFM:NREP 1 HM:PFM:REP 8->297|PF00294|5.1e-38|27.8|281/300|PfkB| RP:SCP:NREP 1 RP:SCP:REP 2->253|2ajrA1|2e-33|20.7|246/319|c.72.1.1| HM:SCP:REP 1->301|2f02A1|7.1e-52|34.1|296/0|c.72.1.1|1/1|Ribokinase-like| OP:NHOMO 293 OP:NHOMOORG 263 OP:PATTERN -------------------------------------------------------------------- --1-2112222-1--------1--12------12221111---1111-11114121-2--1-111122121-------1---1-----------------------------------------------------111-----1--------------------------------------1-------1--11111-121111---1-----111--1---2----1-1--11111111111111-----11-1221-11111--2311-------1111-112-------------111-1111111111-----1--211----------1-1-----------212----------1--111-11------------------------11-------------------1-------------------------2121-----------1---1--1------------------------------------------------------------1---------1---------1-----1----1----------------1------------1-1-----------------------------------------111-------1---------------------1----------11111111111111111-111111111111111-11111111--111--11-111111111111111111-111111111111--------------------------------1----------1-11111111111111-11----------11-------11111-11-1--------------------------------------------------------1-1-1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 193 STR:RPRED 61.1 SQ:SECSTR cEEEEEcccEEEEEEEccccccTTcccccccEEEEEEcHHHHHHHHHHHHTccEEEEEEHHHHHHHHHHHHHHTcccccEEEccccEEEEEEEETTEEEEEEEcccccccHHHHHHHHHHHHHHHTTccEEEEEcccccTccTTHHHHHHHHHHHTTcEEEEEccTHHHHHHHHccccccEEcccHHHHHHHH########################################################################################################################### DISOP:02AL 314-316| PSIPRED cEEEEEEcccccEEEEEccccccccEEEEcEEEEEccccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHccccccEEEEcccccEEEEEEEccccEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHccccEEEccHHHHHHHHHHHHHHcccEEEEcHHHHHHHHcccccccccHHHHHHHHHHHHHccccEEEEEEccccEEEEEcccEEEEccccEEcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccc //