[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : furA
DDBJ      :furA         putative ferric uptake regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->134 3eyyA PDBj 1e-10 27.1 %
:RPS:SCOP  6->135 1mzbA  a.4.5.42 * 1e-16 20.8 %
:HMM:SCOP  5->136 1mzbA_ a.4.5.42 * 1.4e-33 37.1 %
:RPS:PFM   14->121 PF01475 * FUR 2e-10 29.6 %
:HMM:PFM   15->128 PF01475 * FUR 7.7e-22 24.6 114/120  
:BLT:SWISS 1->138 FUR_MYCTU 1e-48 63.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57796.1 GT:GENE furA GT:PRODUCT putative ferric uptake regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 3132619..3133059 GB:FROM 3132619 GB:TO 3133059 GB:DIRECTION + GB:GENE furA GB:PRODUCT putative ferric uptake regulator GB:PROTEIN_ID BAD57796.1 LENGTH 146 SQ:AASEQ MSKVPDFEQLLRGASLRVTAQRLAVLSVVHEHPHSDTDSILGRVRESVGAVSHQAVYDVLRALTTAGLLRRIQPMGSVARYETRVDDNHHHLVCRDCGVIVDVDCAVGEAPCLDASHDHGFVVDEAEVIYWGHCPDCSKALSAPPK GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 1->138|FUR_MYCTU|1e-48|63.0|138/147| SEG 60->71|lralttagllrr| BL:PDB:NREP 1 BL:PDB:REP 6->134|3eyyA|1e-10|27.1|129/133| RP:PFM:NREP 1 RP:PFM:REP 14->121|PF01475|2e-10|29.6|108/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 15->128|PF01475|7.7e-22|24.6|114/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 6->135|1mzbA|1e-16|20.8|130/133|a.4.5.42| HM:SCP:REP 5->136|1mzbA_|1.4e-33|37.1|132/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 84 OP:NHOMOORG 62 OP:PATTERN -------------------------------------------------------------------- ---11---------11111-11--131111112222222221-1211-1111111211--223-1311311-----------1------------------------------------------------------------------------11---------------------------1-11-------------------------------1---------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 134 STR:RPRED 91.8 SQ:SECSTR #####THHHHHHTTTccccHHHHHHHHHHHHHccccHHHHHHHHHTTcTTccHHHHHHHHHHHHHHTcEEEEEcGGGcEEEEETTccccEEEEEcccccEEEEcGGGGHHHHHHHHHHTccccccccccEEEccHHHHH####### DISOP:02AL 1-3, 136-146| PSIPRED ccHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEccccEEEEEcccccccEEEEcccccEEEcccccHHHHHHHHHHHHccEEEEEEEEEEEEcHHHHHHcccccc //