[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : glnA3
DDBJ      :glnA3        putative glutamine synthetase
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  755/915 : Eukaryota  89/199 : Viruses  0/175   --->[See Alignment]
d.128.1d.15.9
:447 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   198->402 2wgsA PDBj 2e-22 35.5 %
:RPS:PDB   14->444 2bvcA PDBj 4e-63 24.8 %
:RPS:SCOP  14->108 1f1hA1  d.15.9.1 * 6e-10 11.6 %
:RPS:SCOP  131->444 1f1hA2  d.128.1.1 * 7e-60 30.2 %
:HMM:SCOP  12->110 1htqA1 d.15.9.1 * 4.6e-16 25.5 %
:HMM:SCOP  110->446 1f52A2 d.128.1.1 * 5.2e-91 41.5 %
:RPS:PFM   171->355 PF00120 * Gln-synt_C 5e-33 43.3 %
:HMM:PFM   111->365 PF00120 * Gln-synt_C 1.3e-74 41.3 247/258  
:BLT:SWISS 16->444 GLNA3_RHILP 2e-70 37.1 %
:PROS 241->256|PS00181|GLNA_ATP
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56950.1 GT:GENE glnA3 GT:PRODUCT putative glutamine synthetase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2276017..2277360) GB:FROM 2276017 GB:TO 2277360 GB:DIRECTION - GB:GENE glnA3 GB:PRODUCT putative glutamine synthetase GB:PROTEIN_ID BAD56950.1 LENGTH 447 SQ:AASEQ MAIDTALAPETATDTLTELARATGTRYILALFVTLTGKPCAKLVPVEAADRLAAGGAGFAGYAAGTLGQQPRDPDLIAIPDPASFTPIPFVRPGLALVHCDPHVDGAPWPYAPRVILAATLARAAARGLTVNVGAEVEYFLVDRDGDGRLRTADRADTSSQPCYDARDVTRMYDHLTEVSAAMNTLGWGNYASDHEDANGQFEQNFDYADAMTTADRVITARYLLSVIAEKRGMRATFMPKPFTDRTGSGMHLHMSLWNATGPLFPDPADGRGLGMSATAYAFIAGILEHACALQGVLAPTVNSYKRLGATATASGATWSPRYASYGGNDRTHYLRVPDPHRVELRGGDGSANPYLAVAAALAAGLDGVDRALDPGAPGAGARHGDMLPMTLLHAMDALDADPVISAALDGAGPGVAAYFSRLKREEFFAWHNTVSAWEIDHYLTAF GT:EXON 1|1-447:0| BL:SWS:NREP 1 BL:SWS:REP 16->444|GLNA3_RHILP|2e-70|37.1|421/435| PROS 241->256|PS00181|GLNA_ATP|PDOC00162| SEG 48->65|aadrlaaggagfagyaag| SEG 117->130|laatlaraaarglt| SEG 309->318|gatatasgat| SEG 356->374|lavaaalaagldgvdrald| BL:PDB:NREP 1 BL:PDB:REP 198->402|2wgsA|2e-22|35.5|197/463| RP:PDB:NREP 1 RP:PDB:REP 14->444|2bvcA|4e-63|24.8|423/475| RP:PFM:NREP 1 RP:PFM:REP 171->355|PF00120|5e-33|43.3|178/256|Gln-synt_C| HM:PFM:NREP 1 HM:PFM:REP 111->365|PF00120|1.3e-74|41.3|247/258|Gln-synt_C| GO:PFM:NREP 2 GO:PFM GO:0004356|"GO:glutamate-ammonia ligase activity"|PF00120|IPR008146| GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00120|IPR008146| RP:SCP:NREP 2 RP:SCP:REP 14->108|1f1hA1|6e-10|11.6|95/100|d.15.9.1| RP:SCP:REP 131->444|1f1hA2|7e-60|30.2|305/368|d.128.1.1| HM:SCP:REP 12->110|1htqA1|4.6e-16|25.5|98/0|d.15.9.1|1/1|Glutamine synthetase, N-terminal domain| HM:SCP:REP 110->446|1f52A2|5.2e-91|41.5|328/0|d.128.1.1|1/1|Glutamine synthetase/guanido kinase| OP:NHOMO 1728 OP:NHOMOORG 910 OP:PATTERN 11-11123323333331121111111111112111111111112112121111111111111111-22 2132322322222324444-45222944444299993353453332222222432323112342423333222222221111411111------------------111---------------------------333331112411141111222111121111211221111111111112111121132111111-11111111122111111112231121111112211111111111111121111111122111111111221111111111111111111111111111111111111111111111111111112--1---------1--------1-1--11113115362132411-11--11-333122222124241113113133333333334-34133332386255545545557645111354555555711111111311131341111111111-------------------3122311111145545422222443533332345211311111233111124214111141342111111111112211211111-11111-11111111111112211111111111111111111111111111221111211113433322322222223233---1123------13111112221211122-2222211222212222221222111111111111111111111422222222111111111111111-1-----222211353111111111-1111122212221114188789887989884455---------31112111111211122333334441111111-111111------------------------------------22122121111-- 111122--1---1122111244242421111-11-111111111-122112232111122221--------------------------352132-1111111112--21------------------------------------------------1---57---------1--1------115111112-1----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 431 STR:RPRED 96.4 SQ:SECSTR #############HHHHHHHHHTTccEEEEEEEcccccEEEEEEEGGGccHHHHHTcEEEETTccTTcccGGGcEEEEEEcGGGcEEcccccccEEEEEEEEETTccccTTcHHHHHHHHHHHHHHHccccEEEEEEcEEEEcccccTTccccccccccTTcccccTTTcccHHHHHHHHHHHHHTTccEEEEEEcccTTEEEEEEccEEHHHHHHHHHHHHHHHHHHHHHTTcEEEccccccTTcccccEEEEEEEEETTEEccccTTcGGHTGccHHHHHHHHHHHHHHHHHHHHHcccTTHHHHccTTccccTTccccccccEEETcTTccEEEcccccEEEccccccccHHHHHHHHHHHHHHHHHTTcccccccccHHTcccccccHHHHHHHHHHccHHHHGGGcccHHHHHHHHHHHHHTHHHHHTcccHHHHHHHT### DISOP:02AL 1-7| PSIPRED ccccccccccccHHHHHHHHHcccccEEEEEEEccccEEEEEEEcHHHHHHHHHcccccccEEccccccccccccEEEEEEccccEEcccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEcccEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccEEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHccccccccccccccccEEEEEEcccEEEEEEccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHccHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcc //