[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : groES
DDBJ      :groES        putative chaperonin GroES
Swiss-Prot:CH10_NOCFA   RecName: Full=10 kDa chaperonin;AltName: Full=Protein Cpn10;AltName: Full=groES protein;

Homologs  Archaea  6/68 : Bacteria  836/915 : Eukaryota  165/199 : Viruses  0/175   --->[See Alignment]
b.35.1
:100 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->100 1p3hA PDBj 3e-51 96.0 %
:RPS:PDB   6->97 2c7cO PDBj 9e-24 46.2 %
:RPS:SCOP  4->98 1aonO  b.35.1.1 * 2e-17 46.8 %
:HMM:SCOP  2->100 1p3hA_ b.35.1.1 * 9.9e-37 52.5 %
:RPS:PFM   6->98 PF00166 * Cpn10 2e-25 67.4 %
:HMM:PFM   5->98 PF00166 * Cpn10 3e-36 49.5 93/93  
:BLT:SWISS 1->100 CH10_NOCFA 9e-54 100.0 %
:PROS 6->30|PS00681|CHAPERONINS_CPN10

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55731.1 GT:GENE groES GT:PRODUCT putative chaperonin GroES GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 988339..988641 GB:FROM 988339 GB:TO 988641 GB:DIRECTION + GB:GENE groES GB:PRODUCT putative chaperonin GroES GB:PROTEIN_ID BAD55731.1 LENGTH 100 SQ:AASEQ MASVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVQEGDTVIYSKYGGTEIKYQGEEYLILSARDVLAVVGK GT:EXON 1|1-100:0| SW:ID CH10_NOCFA SW:DE RecName: Full=10 kDa chaperonin;AltName: Full=Protein Cpn10;AltName: Full=groES protein; SW:GN Name=groS; Synonyms=groES; OrderedLocusNames=NFA_8860; SW:KW Chaperone; Complete proteome; Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->100|CH10_NOCFA|9e-54|100.0|100/100| GO:SWS:NREP 1 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| PROS 6->30|PS00681|CHAPERONINS_CPN10|PDOC00576| BL:PDB:NREP 1 BL:PDB:REP 2->100|1p3hA|3e-51|96.0|99/99| RP:PDB:NREP 1 RP:PDB:REP 6->97|2c7cO|9e-24|46.2|91/92| RP:PFM:NREP 1 RP:PFM:REP 6->98|PF00166|2e-25|67.4|92/93|Cpn10| HM:PFM:NREP 1 HM:PFM:REP 5->98|PF00166|3e-36|49.5|93/93|Cpn10| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00166|IPR001476| GO:PFM GO:0005737|"GO:cytoplasm"|PF00166|IPR001476| GO:PFM GO:0006457|"GO:protein folding"|PF00166|IPR001476| RP:SCP:NREP 1 RP:SCP:REP 4->98|1aonO|2e-17|46.8|94/97|b.35.1.1| HM:SCP:REP 2->100|1p3hA_|9.9e-37|52.5|99/99|b.35.1.1|1/1|GroES-like| OP:NHOMO 1231 OP:NHOMOORG 1007 OP:PATTERN ------------------------------------------11---1--111--------------- 1121111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111112111111111112222411111211111111111111111112211111111111111111111221111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111--------11----------------------------------111111111111111111111111-11111111111111111211211-1122111211111115343322222211111111111-2233231125113111433341342211111111112111111111112211-121111111111111111111111111111112112111111323333222222211333322225111111221111111111111111112221111111111121211111111121111111111111111112321-11111111111111111111111111111111111211111111111111111111-1111111111111111111111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111112111111111-1111111111111111111111111111111111111111111111111111222221212211111111111111111111111111111111111---1---------------------111111-1-1111 21------62--1111111111111-1111111111111111111111111111-11111111-11111-11111111111111--11-121111--111111221-13-211111111-1-1122161111-134-1--11-111-1---11--21111--11111212111122321B1123386A61423321114 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 99.0 SQ:SECSTR #ccccccccccEEEEEEcccccTTTTcccccccccccccEEEEEEEcccccTTcccccccccccTTcEEEEcccccEEEEETTEEEEEEEGGGEEEcEcc DISOP:02AL 1-2| PSIPRED ccEEEEEEcccEEEEEEcccccEEcccEEEccccccccEEEEEEEEccccccccccEEEEEEEccccEEEEcccccEEEEEccEEEEEEEcHHEEEEEcc //